KEGG   Populus trichocarpa (black cottonwood): 7473899Help
Entry
7473899           CDS       T01077                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pop00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    7473899
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     7473899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 7473899
NCBI-ProteinID: XP_002319589
UniProt: A9PHV3
LinkDB All DBs
Position
13
AA seq 152 aa AA seqDB search
MVKAVAVLNSSEGVKGTINFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATVSIIDNQIPLTGPNSIVGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGVIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgttctgaatagcagtgaaggcgtcaaaggcaccatcaacttt
acccaagaaggagatggtccaactactgtaactggaagcctctgtggtcttaagccaggc
cttcatggcttccatgttcatgcccttggagacaccacaaatggctgcatgtcaactggc
ccgcattttaatcctgtaggcaaagagcatggtgcccctgaggatgagaatcgtcatgct
ggtgatttgggaaatgtcactgttggtgatgatggcactgctactgtctcaatcattgac
aaccagattcctcttactggaccaaattccattgttggaagggctgttgttgttcatgca
gatcctgatgatcttggcaagggaggacatgaacttagcaaaaccactggtaatgctggc
ggcagagtagcatgtggtgttattggtttgcaaggctga

DBGET integrated database retrieval system