KEGG   Populus trichocarpa (black cottonwood): 7475777Help
Entry
7475777           CDS       T01077                                 

Definition
(RefSeq) immune-associated nucleotide-binding protein 9
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: AIG1 MMR_HSR1 FeoB_N RsgA_GTPase Dynamin_N Septin DUF1835
Motif
Other DBs
NCBI-GeneID: 7475777
NCBI-ProteinID: XP_024447630
LinkDB All DBs
Position
19
AA seq 335 aa AA seqDB search
MGGSAMDDDWEFASPSNGARTIVLVGRTGNGKSATGNSILGRKAFKSRASSSGVTSSCEL
QRTVLRDGQIINVIDTPGLFDFSAGSEFVGREIVKCINMAKDGIHAVLVVFSVRTRFSQE
EEAALRSLQTLFGSKILDYMIVVFTGGDELEDNDETLEDYLGRECPQPLKEVLTLCENRR
VLFNNKTKDVLKGVEQVQELLSLVNRVIEQNGGQPYSDELFAEIQKGEMNFRGQQEEVDS
LKGNFSIGEISELQEQMKRQYEDQLKRVTDMVEMKLKEATGNLERRLAEEQAARLRAEES
AQLEQRKSNEEIRMLRERLEKAHEELRNKGGCAIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaagtgcaatggatgacgattgggagtttgcttcaccatcaaatggggctcga
acaattgttttagttggacgcacaggcaatggaaaaagtgcgactggtaacagtattctt
ggaagaaaggccttcaagtcaagggctagctcatccggtgttaccagtagttgtgaattg
cagagaactgtactgagagatggtcagattatcaatgtcattgatactcctggacttttt
gatttttctgccggatctgaatttgttggcagagaaattgtcaaatgtattaatatggca
aaggatgggatccatgctgtcctagtagttttctcagttaggacccgcttttcacaagaa
gaagaagcagcccttcgcagcttacaaactttgtttggaagtaagatacttgactacatg
attgtagtcttcactgggggagatgagcttgaagataatgatgagactttagaagactat
ttgggtcgcgagtgtccacaacctttaaaggaagttctcacactgtgtgaaaatcgacga
gttctttttaataacaaaactaaagatgtacttaagggagttgagcaggtgcaggagctt
ctatcccttgtaaacagagtcatagaacaaaatggaggccaaccatacagtgacgaatta
tttgctgaaatacagaaaggggaaatgaacttccgtggtcaacaagaagaggttgattcc
ttgaaagggaatttttctataggagaaatatcagagttgcaggagcagatgaaaaggcaa
tatgaagatcaattgaaacgagtaactgatatggttgagatgaagcttaaagaggcaact
ggtaatcttgagcggcggttagcagaagagcaagctgcacgattacgggcagaagagagc
gcacaattagagcaaaggaaatcaaacgaagaaattcgcatgcttagagagaggctagag
aaggctcacgaggagctccgcaataagggaggctgtgccattctatga

DBGET integrated database retrieval system