KEGG   Populus trichocarpa (black cottonwood): 7476390Help
Entry
7476390           CDS       T01077                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    7476390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pop03036]
    7476390
Enzymes [BR:pop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     7476390
Chromosome and associated proteins [BR:pop03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     7476390
   Polycomb group proteins
    PRC2-EZH2 complex
     7476390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR Phage_Gp23
Motif
Other DBs
NCBI-GeneID: 7476390
NCBI-ProteinID: XP_024457829
LinkDB All DBs
Position
5
AA seq 931 aa AA seqDB search
MASPPPSPPPSASITRSEPPKDSPMIKSNQDTTLASEEVLLVIESLKKQVAADRCIYVMK
RMEENRQKLVGITNHLDKLSKERKNNWISGTDNSIDLFTKRQNDALSMHGGIDSTNVDKD
SHGSEEDGHASTAVLLGSSIPVKNAVRPIKLPEVNRLPPYTSWVFLDRNQRMTEDQSVVG
RRRIYYDQNGGEALICSDSEEEIIDEEEAKRYFVESEDYILRMTIKEAGSSDPVVESLAH
CFSRSPSEVKARFEVLKKEEKAVEDSKNKDIEAQTLNSFLVKDLEAALDSFDNLFCRRCL
VFDCRLHGCSQDLIFLAEKQSPWSYPEDNITCGSHCYKLVLKSERIASGISPQHGVIEEN
SICQSDGARVPISSRKKTSASSARRNVKSCQSESASSNAKNISESSDSEIGPHQDTSPTS
QISPSKSMLVGKGGTCKRNSKRVAERVLSCMRKRQKKMVASDSDSVASGGLLSIDLKRRS
TSHKGKEDASSSHKNAKSPTIARSRRKELMNQDSHNLVQGEFHDGLSSEMVANPPVTSSD
DTLRKEEFIDEHKCKKELSDDRSWKAIEKGLFEKGVEIFGGNSCLIARNLLNGLKTCWEV
FQYMTRSENRPACEAGDAGTLGEGYSKFDFNGTMVKNEARRRSRFLRRRSKVRRLKYSWK
STAYHSFRKRITERKDQPCRQYNPCSCQTACGKQCTCLLNGTCCEKYCRCPKSCKNRFRG
CHCAKSQCRSRQCPCFAADRECDPDVCRNCWISCGDGTLGIPSQRGDNYECRNMKLLLKQ
QQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLN
DQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVTGDHRVGIFAKERINAGEELFYDYRYEP
DRAPAWARKPEASGSKKEDGGHSSGRAKKLA
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgccgccgccatcgccaccgccgtctgcttccatcaccagatcggagcctcct
aaggactctccgatgataaagtctaatcaggataccactcttgcaagcgaagaggtttta
ttagttattgaatcgttaaagaagcaagttgcggctgaccgatgcatttatgttatgaaa
aggatggaagagaacagacaaaagttggttggcattacaaaccacctcgataagttgtca
aaggaaaggaagaacaattggattagcggtactgacaacagtatagatttatttacaaag
aggcaaaacgatgcactcagtatgcatggtggtattgactcgactaatgtagataaggat
agccatggctctgaagaagatggtcatgcttccactgcagttcttttgggttccagtatt
ccagtgaagaatgcagtacggcctattaagctacctgaagtgaatagattaccaccttat
acatcatgggttttcttggacagaaatcaaagaatgacagaggatcaatcagtggttggt
cgaaggagaatttattatgaccaaaatgggggtgaagcactaatctgcagtgacagtgaa
gaggaaataattgatgaagaagaggcgaagagatattttgtagaatctgaagattatatt
ctgcggatgacaatcaaagaagctggttcatccgatccagtggtggaatcactagctcat
tgtttttctagaagccctagtgaagtgaaggcaagatttgaggttcttaagaaggaagag
aaggctgtggaggattctaagaataaagatattgaagcacaaacactgaattctttcctt
gttaaagatcttgaagctgctttggattcgttcgacaacctattttgtcgcagatgcctt
gtatttgattgtagattacatggatgttcgcaggatcttatcttccttgctgagaaacaa
tctccatggagctatccagaagacaacataacatgtgggtcacactgctacaaattggtt
ttgaagtcagaaagaattgcctcagggatttctcctcagcatggggttattgaagaaaat
tctatctgtcaatcagatggtgctagggtacctatatcatcaaggaagaaaacttctgct
tcatctgccagaaggaacgtgaagtcctgccaaagtgaaagtgcttcatcaaatgcaaaa
aacatttcagagagcagtgactcagagattggacctcatcaggacacctctcccactagt
cagatatcaccttccaagtctatgcttgtggggaaaggtgggacttgtaagaggaacagc
aagcgagtggctgaacgtgttctaagttgcatgcggaaaaggcagaagaaaatggtggct
tctgattccgattctgttgctagtggaggccttttgtcaattgatttgaaacgtagatcc
acctcgcacaaaggaaaggaagatgcaagttcttctcataagaatgcaaaatctcccacc
attgcaaggtctaggaggaaagaattgatgaatcaggacagccacaacttagtgcagggt
gaatttcatgatggtctatcaagtgagatggtcgctaatccacctgtgactagcagtgat
gacaccttgaggaaagaagagttcatagatgaacataaatgtaaaaaagagttaagtgat
gacagatcttggaaagctattgaaaaaggcctatttgagaaaggtgttgagatttttggc
gggaacagttgcttaattgctaggaaccttttaaatggtttaaaaacatgctgggaggtt
tttcaatacatgactcgctctgagaataggccagcatgcgaagcaggtgatgctggaact
cttggtgaagggtactccaagtttgatttcaatggaacaatggttaagaatgaagcaaga
aggagatcaagatttttaaggagaagaagtaaagttcgtcgcttgaagtactcttggaaa
tctactgcttaccattcttttaggaagcggataactgaaagaaaagatcaaccttgtcgt
cagtataatccatgtagttgtcaaactgcttgtggaaagcagtgcacttgtttgctaaat
ggcacgtgttgtgagaagtattgcagatgtcctaagagttgcaagaaccgatttagaggc
tgtcattgtgctaaaagtcaatgtagaagtcgtcaatgtccatgctttgctgcagacagg
gaatgtgatccagatgtttgtaggaattgttggattagttgcggtgatggtactctcggt
attcccagccaaaggggggataattatgaatgcagaaatatgaagcttcttcttaaacaa
caacagagggttttacttggaagatctgatgtatcaggctggggtgctttcttgaagaat
agtgttggcaagcacgagtacctgggtgagtacactggtgagctgatttcacatagggaa
gcagataagcgtgggaagatatatgaccgtgaaaattcatcatttctcttcaatctcaat
gatcagtttgttcttgatgcataccggaagggtgacaagctaaagtttgccaaccattct
ccagaccctaattgctacgctaaggtcataatggttacaggggatcaccgagtgggcata
ttcgccaaagaacgaattaatgccggggaggaacttttctatgattatcgttatgagcca
gacagagctcctgcctgggctaggaagcctgaagcatctggatcaaagaaggaagatggt
ggtcattcaagtggccgtgcaaagaagcttgcttaa

DBGET integrated database retrieval system