KEGG   Populus trichocarpa (black cottonwood): 7477456Help
Entry
7477456           CDS       T01077                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop03030  DNA replication
pop03410  Base excision repair
pop03420  Nucleotide excision repair
pop03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pop00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    7477456
   03410 Base excision repair
    7477456
   03420 Nucleotide excision repair
    7477456
   03430 Mismatch repair
    7477456
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pop03032]
    7477456
   03400 DNA repair and recombination proteins [BR:pop03400]
    7477456
Enzymes [BR:pop01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     7477456
    6.5.1.6  DNA ligase (ATP or NAD+)
     7477456
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     7477456
DNA replication proteins [BR:pop03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    7477456
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     7477456
DNA repair and recombination proteins [BR:pop03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     7477456
   NER (nucleotide excision repair)
    Other NER factors
     7477456
   MMR (mismatch excision repair)
    Other MMR factors
     7477456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL UBA_4 Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 7477456
NCBI-ProteinID: XP_024455271
LinkDB All DBs
Position
4
AA seq 1431 aa AA seqDB search
MAFQSDHQTPQSINSQTLYYKSLTSLSLQIPPTPSSFLPLPPSLPPSKLIPKTRFLIDGF
RFSSPSITAYFLSHFHSDHYTGLSSHWSQGIIFCSPITTSLVTSILNVPECFVFSLPLNR
AVDIDGVEVSLVDANHCPGAVQFLLKVPICKNLDNFELYVHTGDFRYSCEMKDDVFLRGF
VGCNTVFLDTTYCNPKFVFPLQEESVDYVVSAIEKIGGEGFSGGLEKRVLFLVATYVVGK
EKILIEIARRCNRKVYVDARKMEVLRVLGCGESGVFTEDENESDVHVVGWNVLGETWPYF
RPNFVKMKEIMVERGYNKVVGFVPTGWTYEVKRNKFAVRSKDSCEIHLVPYSEHSNYNEL
REYVKFLRPKRVIPTVGVDVEKLDSKHAAKMQKHFAGLVDEMANKKEFLMGFLRGSSEND
KKVEMDAVSGLNEGLAQEKELVESVEMKAHENNDTVACLNSSSILQESPTHNLSMLNDEE
RDKLVHELSDCLPTWVTRDQMLDLISTHGRNIVEAVSSFYEREMEFHDQVISCRVTVSSS
ETVPLYDSESPSKPASINTDSRSMGFLSGQNYKSPSKNPKLKGGNSPGKRKRSVGNKPGK
KSKINSKLESGLSKQSTITKFFNKVLPDASQVSVVASISEQCPGDENLLQNDDVTESYRE
EVDQFIQIIDGNESTRSYAATILKKTEGDINKALDMHYGDPMGNLGKSIEALVVSGNMVE
RQCETGSSSAREKELFGEIENMVDLSVQGSLIKNVDATLVSLPTEKYNPIEHACWNGGQP
APYIHLARAFDLVEAEKGKIKVTSLLCNMFRSLLALSPEDVLPAAYLCTNKIAADHENVE
LNIGGTLVTSALEEACGTNRSKIREMYNSMGDLGDVAQVCRQTQTLLAPPPPLLIKDVFS
ALQKISVQTGSGSTGRKKSLIVNLMRSCREKEMKFIVRTLVRNLRIGAMMRTILPALAQA
VALNSFSSDECKAENVKEKLQYISTAVVEAYNILPTLDLVVPSLINEGVGFSSSTLSMVA
GIPLKPMLAKITNGVAQVLKLFENKAFTCEYKKPSGHINVCQLAFYAYNSGDSGYDGQRA
QIHKMPNGTVRIYSRNGDETTSRFPDLIKIIEESCKPAAATLIVDAEVVAVDRKNGCKLM
SFQELSSRERGSKDSSIAVNKIKVDICVFVFDIMFANGEQLLELPLRQRRQYLKDLFCDE
RLGCFEYAKEMTVEAQDACLTNDATLTKMKSFLEDALRSSCEGIMVKSLDIDAGYCPSKR
TDAWLKVKKDYVEGLNDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPETEEFQSVCRVMS
GFSDAFYIEMKEFFSGDRILAKKPPYYRTVEAPDMWFSPEVVWEIRGADFTISPVHQAAV
GLVHQSRGISIRFPRFIHSISDRNPEECSTAADIAEMFNSQTRKMDVTAER
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcaatccgatcaccaaaccccacagtccataaactcacaaaccctatactac
aaatccctcacttcactttccctccaaatccctccaaccccatcatccttcctccctctc
cctccttctctccctccttcaaaactcatccccaaaacccgtttcctcatcgacggattc
cgcttttcctccccttccattactgcctacttcctctcccacttccattctgaccattac
actggtctttcctctcattggtctcaaggtatcattttttgttccccaatcactacctct
cttgttactagtatccttaatgtccctgaatgttttgtcttttcgcttcctctgaatcgt
gctgttgatattgatggtgttgaagttagtttagttgatgctaatcactgtcctggcgct
gttcagttcttgttgaaagtgcccatttgtaagaatttagataattttgagttgtatgtt
catactggtgattttaggtactcttgtgagatgaaagatgatgtttttttgagaggtttt
gtggggtgtaatacggtttttttggatactacttattgtaatccgaaatttgtgtttcct
ttacaagaggagtcggttgattatgttgttagtgcgattgagaagataggaggagagggg
ttcagtgggggtttggagaagagggttctgttcctcgtggctacttatgtggtggggaaa
gaaaagattttgattgagattgcacggaggtgtaataggaaggtctatgtggatgccagg
aaaatggaggttttgagggttttggggtgcggggagagtggggtgtttacagaggatgag
aatgagagtgatgtgcatgttgttggctggaatgtcttgggggaaacttggccttatttt
cggccgaattttgtgaaaatgaaggaaattatggtggaaagaggttacaataaggttgtg
gggtttgtgccaactgggtggacatacgaagtgaaacgtaataagtttgcagtgagatca
aaggattcatgtgagattcatcttgtgccatatagtgagcattcaaattacaatgaactc
agggagtatgtgaagtttttgagacctaaacgtgtcattcctactgttggtgtggatgtt
gaaaaactcgatagtaaacatgctgctaaaatgcagaagcattttgctgggttagttgac
gagatggctaataagaaggaatttttaatgggttttcttcgtgggtcgtctgagaatgat
aagaaggttgaaatggatgctgtctcaggcttgaacgaggggctggcgcaggagaaagag
ttagtggagtcagttgaaatgaaagcccatgagaataatgacactgttgcttgtctcaac
tcctcatctatactgcaagaatctcctacacacaatttaagcatgctaaatgatgaggaa
agagataaactcgttcatgaattgagtgattgtttgcccacatgggttacccgagaccaa
atgttagatttaatcagcactcatgggaggaatattgttgaagcagtttctagcttttat
gaacgtgaaatggaattccatgatcaagtaatttcttgtagagtaactgtttcttcatct
gagacagttccattatatgactctgaatcaccttcaaaaccagcttctattaatactgat
agtcgaagtatgggttttctgtcaggtcaaaactacaagtcacctagcaagaatcctaaa
ctaaagggtggtaattctcctggaaaaaggaagaggagcgttggcaataagcctggcaag
aaatcaaaaattaattcaaagctggaatctggcttgtcgaagcaatccaccattactaag
tttttcaataaagttttgcctgatgcttctcaagttagtgtggttgcatctatatctgag
caatgccctggagatgaaaatttgttgcaaaatgatgatgttacagagtcatacagggag
gaggtagatcagtttattcagataattgatggcaatgagtcaacaagaagttatgctgcc
accatcctcaagaagacagaaggagatattaacaaggctctggacatgcattatggtgat
cccatgggtaaccttggcaagagtatagaggctttggtggtttctggcaatatggttgag
cgccagtgcgaaactggctcctcttctgccagggagaaagaattgtttggagaaatagaa
aatatggttgatctatccgttcagggatcattaataaaaaacgtggatgcaactcttgta
tcactaccaacagaaaaatataatcccatagagcatgcatgctggaatggtggacaacct
gcaccatatatccatcttgcacgtgcttttgacctggtcgaggcagaaaaaggaaagatc
aaagttacttcgttattgtgcaatatgtttagaagtttgctggcattgtctcctgaggat
gtgctgcctgctgcctatctgtgcacaaataagattgctgctgaccatgaaaatgtggaa
ctaaacataggtggaaccttggttacatcggctttggaagaggcatgtggaacaaaccgg
tctaaaataagggaaatgtacaatagtatgggggatcttggtgacgttgctcaagtatgc
cgacaaacacagacattactggctcctcctcctccccttcttattaaagatgtattttct
gcgctgcagaagataagtgtacaaacaggtagtggaagtactggtcgaaagaagagcctc
attgtgaatcttatgcgttcttgtagggagaaggagatgaagtttattgtcagaactttg
gtaaggaatttacggattggagcaatgatgagaactatcctacctgctttagctcaagct
gttgctttgaattccttttcttctgatgaatgtaaagctgagaatgtgaaggagaaactt
cagtacatttccacagcagtggttgaagcttataacatccttcctactctggatttggtt
gttccttcactcataaatgaaggcgttggattttcatcgtcaactttatcaatggttgct
gggatacctcttaaaccaatgcttgcaaaaattacaaatggagttgctcaagtactaaag
ctctttgaaaataaagcttttacatgtgaatacaaaaaacctagtggtcacatcaatgta
tgccagctagcattttatgcttacaacagtggagattccggatacgatggtcagcgtgcc
caaattcacaaaatgccaaatggcactgtacgtatctattcacgaaatggggatgaaaca
acttctaggtttcctgatttgatcaagataattgaggaatcttgtaaacctgctgcagcg
actttaatagtggatgcagaggtagttgcagttgatagaaagaatggctgcaagctcatg
tcctttcaagagctatcttcaagggagagagggagcaaagattcttccattgctgtgaat
aagataaaggttgatatatgcgtgtttgtctttgatatcatgtttgctaatggagaacag
ctgttggagcttcctctccgccaaaggcgacaatacttgaaagacttgttttgtgatgag
agattaggttgttttgaatatgcgaaggagatgacggttgaagcacaggatgcttgtttg
accaatgatgcaactttgaccaagatgaaatctttccttgaagatgcattgcggtcctcg
tgtgaagggattatggtgaaatctctagatatcgatgctggatactgtccatcaaaacgg
actgacgcatggttaaaggtcaagaaggattatgttgaaggactgaatgattctcttgat
ttagtcccgattggtgcttggcatggaaatgggagaaaagcaggatggtatagtccattc
ctcatggcatgctacaaccctgagactgaggaattccaaagtgtgtgccgtgtcatgtct
gggttctcagatgctttttatatagagatgaaagaattcttctctggagataggatcttg
gccaaaaagccaccatactatcgaactgtggaggcgccggatatgtggttttctccagaa
gttgtttgggaaataagaggtgctgactttacaatttcacctgttcaccaggctgctgta
ggtttagttcatcaatctcgtggcatctcaatcagatttccaagatttattcactccata
tcggatagaaatccagaggaatgtagcacagcagcagatatagctgaaatgtttaattct
caaacaaggaagatggacgtgacagctgaaagatga

DBGET integrated database retrieval system