KEGG   Populus trichocarpa (black cottonwood): 7479874Help
Entry
7479874           CDS       T01077                                 

Definition
(RefSeq) probable lysine-specific demethylase ELF6 isoform X2
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN zf-C2H2 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 7479874
NCBI-ProteinID: XP_002312010
LinkDB All DBs
Position
8
AA seq 1621 aa AA seqDB search
MGNVEIPKWLKGLPLAPEFRPTDTEFADPVAYISKIEKEASAFGICKIIPPLPKPSKRYV
FSNLNRSLSKCPELGDDVDLSNVCSSSNGGLRDGGNDGENRAVFTTRQQELGQCVKKAKG
MVKENLQSGVHKQVWQSGEAYTLEQFESKSKAFARSLLGMLKEVNPLVIEALFWKAASEK
PIYVEYANDVPGSGFGEPESHSRYFPRRRRKRASYQSYRRSRESPVCSTNDMDDVKNSHN
DEVKGVSIKNVPSLCLETTPRSSMASLTSFAEDNLMYSKQKSVTATNDMEGTAGWKLSNS
PWNLQVIARSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGSPK
TWYAVPGDYVFSFEEVIRTEAYGGNIDRLAALSLLGEKTTLLSPKAIISSGIPCCRLVQN
PGEFVVTFPRAYHVGFSHGFNCGEAANFGTPQWLKVAKEAAVRRAAMNYLPMLSHQQLLY
LLTMSFVSRVPRSLLPGARSSRLRDRQREERELSVKEAFLEDMLKENDILSAFLEKNSTC
HAVIWNPDLLPCASKESHLLNITSTITTTPKQNASHNNFDVNRNCNENDLFKEMSLYMET
LDDLYMEEDDLSCDFQVDSGTLACVACGILGFPFMSVLQPHEKASIELMPGEEPRVTRID
NVQPSLDSDSTGKGSVSDDHGPVKDYSVPLKDLPMPTGWNTSHKFLRPRIFCLEHGVQIE
ELLQSKGGANLLIICHSDYQKIKAHAYAIAEEIESPFNYNEVPLEAALKEDLNLINLAID
DEDHHECGEDWTSKLGINLRYCVKIRKNSPSKKVQHALALGGLFSDRSLTDFLNIKWQSR
RSRSRIKLNQPFHPKPCKIIEPDKDEMSGNKSDGLTVKKEEKLVQYTRRKYKVKIDYSTN
GLEGCSRRCFAEEVSGASGDDPDKYTEQTTVIYPCNIGITRSGSAGFGFSPIEDPEMLHE
VKVLEAAGGLTLNSAPSQDACSVLTATVAVKSVGGQIEDQLLKESKNARNICNVKASGTS
EIEHQINASGGTSEKQDFYATKCCSPFITVANERFEMQREDQVLGNVNMGETCNMVSEGQ
QRVLDDGDASVDEVSDLANVASLHVSPPPIGLRADVVVENSFINNEVSPPVTLDDEVKKE
LVTKNRTNGDQCSSSDDTLMNQPTTSLDERCGHEQETRAVQNKTQKEAEIKNGSNDEIVP
SNVISVTNLVPIDESSEFHRELHATVNLCNGMAFENGKQLVFQTTNDSNKELISCSVAQM
EINSSTASSEFSKLHRQAYAENDLCSGSTLDTIVPPEIPTTDIRTVEELASNSATINQEL
SEASKEICAIQDSYACMDLEPEVEKEIHSSDGVTRDSEVQKIHQGTSLINEDIHVSARVI
LVNQPPTPSPVIKCSNIDDKSCVGESMVTCNKFFSSQEIESIESAVVDSRPTAGKGRKRK
GEVEQLTENKFDSNGFIRSPCEGLRPRAGKDVGKSAEENPIPKRLKKPSNVSVSRSKRKE
ITQRSYKCDLEGCRMRFETKAELQLHKGNRCTYDGCGKKFSSHKYAIVHQRVHEDDRPLK
CPWKGCTMSFKWAWARIEHIRVHTGEKPYQCKVDGCGLSFRFVSDFSRHRRKTGHYLNTP
D
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgtggaaatacccaaatggctaaaagggttgcctttggcacccgagtttagg
ccaactgatactgaatttgcagacccagttgcatatatatcgaaaattgagaaggaagct
agtgcttttgggatttgtaagatcatacccccattgcctaagccttcgaaaagatatgtt
tttagtaacttgaataggtcgctttctaagtgtccggagttgggtgatgatgtggacttg
tcgaatgtttgttcctcgtcaaacggtggtttaagggatggtggtaatgatggggagaat
agggcggtgtttacaactaggcagcaggagttagggcagtgtgtgaagaaagcaaaaggg
atggttaaggagaatctgcaatcaggtgttcataagcaagtgtggcaaagtggggaggct
tacacattggaacagtttgagtcaaagtctaaggcttttgcaaggagtttgttaggtatg
cttaaggaggttaatccattggttatagaggcattgttttggaaggcagcttctgagaag
cctatctacgtggaatatgcaaatgatgtgcctggttcgggttttggggaaccagaaagc
cactctaggtactttcctagacggaggaggaagagggcatcatatcagtcttatcgcagg
agtagagaaagccctgtttgcagtacaaatgatatggatgatgtaaagaattcccataat
gatgaggttaaaggtgtttccattaagaatgtgccaagcttgtgtttggagacgacaccc
aggtcatctatggcatctttgacttcattcgcagaggataatctgatgtattctaagcaa
aaaagtgtaactgcaactaatgatatggaaggtactgcaggttggaaactttcaaatagc
ccttggaatctgcaggtgatcgcgcgctcacctggctctcttacacgatttatgccagat
gatatcccaggtgttacttcacctatggtctacattggtatgttgtttagttggtttgct
tggcatgttgaggatcatgaacttcacagcatgaattttctacataccggttctccaaag
acttggtatgctgtccctggagattatgtattttcttttgaggaagttatacgcactgag
gcttatggtggcaatattgatcgcttagctgccctgagtctgttgggtgagaagacaact
cttctgtctcctaaagcaataatttcctcaggcattccttgttgtaggttagtacagaat
cctggtgaatttgttgtgacttttccaagggcctaccatgtaggattcagccacggtttt
aactgtggggaagctgccaattttggaactccacaatggcttaaagtagccaaggaagct
gcggtccgtagagctgccatgaactatcttcccatgctttcacatcagcagcttctatac
ctgttgaccatgtcttttgtttcaagggtgccgagatccttactaccaggtgctcggagt
tctcgtcttagagatcgtcagagagaagaaagagagttgtcagtaaaggaggcttttcta
gaagacatgttaaaagaaaatgacattttatctgcttttcttgagaaaaactccacttgt
catgcggtgatatggaaccctgatttgcttccttgtgcaagtaaagagtctcacttactc
aacataacttctactattactaccacaccaaaacaaaatgcttcccataataatttcgat
gtaaataggaattgcaatgagaatgacctgtttaaggagatgagcttgtatatggaaact
ctcgatgatttatatatggaagaagatgatttgtcatgtgattttcaagttgattcgggg
acattagcatgtgtggcttgtggaatccttggttttccttttatgtcagtgttgcaacca
catgagaaagcatcaatagaattgatgcccggcgaagagccaagagttacaagaattgat
aatgttcagccctctttagactctgatagcaccggcaaaggctctgtttcagatgatcat
ggtcctgtcaaagattattctgtgcctctgaaggatcttccaatgcccacagggtggaac
acttctcataagtttttgagacctcgtattttctgcctggagcatggtgtccaaattgag
gagctgttacagtctaaaggtggagctaacttgcttataatttgccattcagactatcaa
aaaataaaagcacatgcttatgccatcgctgaggaaattgagagtcctttcaattataat
gaggttcctttagaagctgcattgaaagaagatctgaacttgataaatcttgcaattgat
gatgaagatcatcatgaatgtggagaagactggacatcaaaactgggcatcaacttacgg
tattgtgtaaagatcagaaagaactctccatctaagaaagtccaacatgcattggcattg
ggaggattattctctgacagaagtctcacagatttcttaaacatcaaatggcaatctaga
agatctcggtcaagaataaagttaaatcagcctttccatcctaaaccatgcaagattatt
gaaccagacaaagatgaaatgtcggggaataagtcagatggtctcactgtcaaaaaagag
gaaaaacttgttcagtacactagaaggaagtacaaggtaaaaatagattattcaacaaat
gggcttgaaggatgctctagaaggtgctttgcagaagaggtttcaggagctagtggtgat
gatcctgataaatatactgaacaaacaactgtaatttacccttgcaatattgggattacc
agaagtggttctgcaggatttggtttttctcccattgaagatcctgaaatgctgcatgaa
gtcaaggtgcttgaagcagctggtggtttgaccttgaattctgctccatcacaagatgca
tgttcagttctcactgctactgttgctgtcaaaagtgttgggggccagattgaggatcaa
ctgctgaaggaatcaaaaaatgcgagaaatatttgtaatgtaaaagccagtggtacttct
gagatagagcatcagataaatgcctctggaggaaccagtgaaaaacaggatttttacgcc
acaaaatgctgtagtccattcatcactgtagctaatgaaagatttgaaatgcagagagag
gatcaagttttgggaaatgtcaacatgggtgagacttgtaatatggtttctgaagggcaa
cagagggtcctggatgatggcgatgcttcagtagacgaggtttctgatcttgctaacgta
gcaagtttacatgtttctcccccccccatcggactaagggcggatgtagttgtggagaat
tctttcattaacaatgaggtatctcctcctgtgactttggatgatgaagtgaaaaaagaa
cttgtgactaaaaacagaactaatggtgaccaatgctcttcaagtgatgacacattgatg
aatcagcctactacctcactggatgaaagatgtggtcatgagcaagagacccgtgctgta
caaaataagacgcagaaagaagctgaaataaaaaatgggagtaatgatgaaatcgttccg
agtaatgttattagtgtgactaatcttgtgcctatagatgaaagttctgaatttcataga
gagctgcatgccacagtcaacttgtgcaatggcatggcttttgaaaatggcaagcagctg
gtgtttcagaccacaaatgattctaacaaggaacttatctcatgttctgttgcacaaatg
gaaataaattcatctactgcttcatcagaattctctaaacttcataggcaggcctatgct
gaaaatgatttgtgcagtggctcaactttggacaccattgtgccaccagaaattccaact
acagacatacgcactgtggaggaacttgcctctaattctgcaaccataaatcaagaactt
tctgaagcttcaaaagagatttgtgctattcaagactcgtatgcttgcatggatttagaa
cctgaagtagagaaggaaattcattccagtgatggggtgactagagacagtgaggtgcag
aaaatacaccagggcacaagtttgattaatgaggacatacatgtttctgctcgtgttatt
ctggtaaatcagccgccgactccttccccagttataaaatgttccaacattgatgacaaa
tcatgtgttggagaaagcatggtgacgtgcaacaaatttttttcatctcaggagattgag
agcatcgagtctgctgttgtagactctagaccaactgctggaaagggaagaaaaagaaag
ggtgaagtggagcagctaacagaaaacaagttcgatagcaatggctttattaggagtcca
tgcgaaggattgagaccgagggctgggaaagatgttgggaaatcagctgaggagaatcca
ataccaaagaggttaaagaaaccttctaatgtttcagtttctcgctcaaaaaggaaagaa
atcacacaaagatcttacaagtgtgacctagaaggttgccgcatgaggtttgagacaaaa
gcagagttacagttgcacaagggcaatcgatgcacatatgatggatgtggtaagaagttt
agttcccacaaatatgcaatagttcatcaacgtgttcatgaagatgatagacccctcaag
tgtccatggaagggttgcaccatgtcattcaagtgggcatgggctaggattgagcatata
cgggtgcacactggtgaaaagccataccagtgcaaggtcgatggctgtggcctttctttc
aggtttgtatcagactttagtcggcataggaggaaaacaggacactatttgaacacacct
gactga

DBGET integrated database retrieval system