KEGG   Populus trichocarpa (black cottonwood): 7481430Help
Entry
7481430           CDS       T01077                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop00053  Ascorbate and aldarate metabolism
pop00071  Fatty acid degradation
pop00280  Valine, leucine and isoleucine degradation
pop00310  Lysine degradation
pop00330  Arginine and proline metabolism
pop00340  Histidine metabolism
pop00380  Tryptophan metabolism
pop00410  beta-Alanine metabolism
pop00561  Glycerolipid metabolism
pop00620  Pyruvate metabolism
pop00903  Limonene and pinene degradation
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7481430
   00053 Ascorbate and aldarate metabolism
    7481430
   00620 Pyruvate metabolism
    7481430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    7481430
   00561 Glycerolipid metabolism
    7481430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    7481430
   00310 Lysine degradation
    7481430
   00330 Arginine and proline metabolism
    7481430
   00340 Histidine metabolism
    7481430
   00380 Tryptophan metabolism
    7481430
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    7481430
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    7481430
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     7481430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 BMC
Motif
Other DBs
NCBI-GeneID: 7481430
NCBI-ProteinID: XP_002301540
UniProt: B9GSY7
LinkDB All DBs
Position
2
AA seq 540 aa AA seqDB search
MAAKKISTVLSRSFSSAAAPPCFFSRVRGGGGQSRLISRYNTTLAAVEDPITPPVSVKYN
QLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNRAVSAARKAFDEGPWPRMTA
YERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQSAKIEIPMTVRIFRYYAGWADKIHG
LTVPADGPYHVQTLHEPIGVAGQIIPWNFPMLMFSWKVGPALACGNTVVIKTAEQTPLSA
VYAAKLFHEAGLPDGVLNVVSGFGPTAGAALASHMDVDKLAFTGSTDTGKIVLELASKSN
LKPVTLELGGKSPFIVCEDADVDQAVELSHSAVFFNQGQCCCAGSRTFVHERVYDEFVEK
AKARANQRAVGDPFKEGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTGYYI
QPTVFSDVQDDMLIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDTANT
LSRALKVGTVWINCYDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTSLKNPAWL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagaagatatcaactgtgctctctcgctctttctcttctgctgctgctcct
ccatgtttcttttcgagagtgaggggtggtggtggtcagagcagattaatctctagatat
aatactactttggctgctgttgaggacccgattactccccctgtctctgtcaaatacaat
caactcttaattaatggacaattcgtggatgcagcatcaggaaagacgtttccaacattg
gatccgaggacaggggaagtgattgctcatgttgctgaaggtgatgttgaagatgtaaac
agagcggtctctgctgcccgcaaggcttttgatgaaggaccatggccacggatgacagct
tatgaaaggtcaaggatcatttggcgttttgctgatttgcttgaaaagcatactgatgaa
attgcagctcttgaaacgtgggataatggcaaaccatatgagcaatctgctaaaattgaa
ataccaatgactgtgcgtatatttagatactatgctggttgggcagataaaatccatggc
ctcacagttcctgctgatgggccatatcatgtacaaaccttgcatgaaccaattggtgta
gcaggtcagattattccatggaattttccaatgctcatgttttcttggaaggttgggcca
gcattagcatgtggcaacaccgttgttataaagacagcagagcagaccccattgtctgct
gtatatgcagccaagctatttcatgaggctggacttccagatggtgttctgaatgtggtt
tctggtttcggtccaaccgctggtgctgctcttgctagccatatggatgtggataagctt
gcattcacaggatcaactgataccgggaaaatagtacttgagttggcatcaaaaagcaat
cttaaaccagtaactttggagcttggagggaaatcacctttcattgtctgtgaggatgct
gatgttgatcaggctgtagagctttctcactctgctgtattctttaatcagggccaatgc
tgctgtgctggttctcgtacatttgtgcacgagcgtgtgtacgatgagtttgtggagaaa
gcaaaggcacgtgccaaccagcgtgctgttggtgatccattcaaagagggaattgagcaa
ggccctcaggttgattcagaccaatttgagaagattttgaggatcataagatctggtgtt
gagagtggagcgaaccttaaagctggaggcgacagatttggcacaactggatattatatc
cagcccactgttttctcagatgttcaggatgacatgctgatagcaaaggaggagatattt
gggccagttcagtccatctttaaattcaaggacctggatgaagtcatacaaaggtccaac
aacagtcgctacggacttgctgcagggattttcacacataacttagacaccgccaacacc
ctttcacgtgcattgaaggttggaacagtatggataaattgctatgatgtcttcgatgct
gccattccttttggtggatacaagatgagtggaaatggtagagaaaagggaatttacagt
cttaacaactacttgcaagtgaaggctgtcgttacctcactcaagaatccagcctggcta
tag

DBGET integrated database retrieval system