KEGG   Populus trichocarpa (black cottonwood): 7481618Help
Entry
7481618           CDS       T01077                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00040  Pentose and glucuronate interconversions
pop00051  Fructose and mannose metabolism
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7481618
   00051 Fructose and mannose metabolism
    7481618
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     7481618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PALP Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 7481618
NCBI-ProteinID: XP_002318842
UniProt: B9I4E4
LinkDB All DBs
Position
12
AA seq 370 aa AA seqDB search
MAHGGGAAADVMACKQEEEEEVENKAAWLLGIKTLKIQPYHLPPLGPLDVKVRIKALGIC
GSDVHHFKTMRCASFVVKKPMVIGHECAGIIEDVGSEVKSLAVGDRVALEPGISCRRCNL
CKEGRYNLCPEMKFFGSPPTNGSLANKVVHPANLCFKLPDNVSLEEGAMCEPLSVGVHAC
RRAQIGPETNVLIMGAGPIGLITLLASRAFGAPRVVIVDVDDRRLSIAKNLGADEIIHVS
TNIQDVDEEVIKIQNAMGSGIDVSFDCVGYNKTMTTALNATQSGGKVCLIGLALTEMTVP
LTPSAAREVDVIGIFRYRNTWPLCIEFLKTGKIDVKPLITHRFRFSQEEVEQAFETSAGG
GNAIKVMFNL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcacatggtggtggtgctgctgctgatgttatggcatgcaaacaagaagaagaagaa
gaagtagagaacaaggctgcttggcttcttgggatcaaaaccctaaagattcagccttac
catcttcctcctcttggtcctcttgatgttaaagtaaggatcaaagcacttggtatatgt
ggaagtgatgttcatcacttcaagacaatgagatgtgcaagctttgttgtcaagaagcca
atggttataggacatgaatgtgctgggatcatagaagacgttgggagtgaagtgaagtct
ctagctgttggtgatcgagtagcattggaacctggaatcagttgccgaagatgcaatctt
tgcaaagaaggtcgctacaatttatgtccagagatgaagttctttggttctccaccaacc
aatggctctctagctaacaaggtagtgcatcctgcgaatctttgtttcaaactaccagac
aatgtgagcctggaggaaggagctatgtgtgagcccctcagtgttggtgtccatgcctgt
cgccgtgcacaaattggtcctgagacaaatgtattgatcatgggagcaggaccaataggc
ctcatcactttgcttgcttctcgtgcatttggcgcccctagagtggtgattgttgacgtt
gatgatcgccgtttatccattgcaaagaatcttggtgcagatgagatcattcatgtctca
acaaatattcaggatgtcgatgaagaggtaataaagatacaaaatgctatgggttcagga
attgatgtgagctttgattgtgttggatacaacaaaaccatgactacagccctgaatgcc
actcaatcaggtggtaaagtttgccttattggtttggccctgactgagatgactgtccct
cttaccccatcagctgcaagggaggtggatgttattggcatattccggtacaggaacaca
tggccgctctgtattgaattcttgaaaaccggcaagattgatgttaagcctttgataact
cacagatttaggttctcacaagaggaggtagaacaagcctttgagactagtgctggtggt
ggcaatgccattaaggtcatgtttaacctgtaa

DBGET integrated database retrieval system