KEGG   Populus trichocarpa (black cottonwood): 7481744Help
Entry
7481744           CDS       T01077                                 

Definition
(RefSeq) uncharacterized protein LOC7481744
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00270  Cysteine and methionine metabolism
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    7481744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pop03032]
    7481744
   03036 Chromosome and associated proteins [BR:pop03036]
    7481744
Enzymes [BR:pop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     7481744
DNA replication proteins [BR:pop03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    7481744
Chromosome and associated proteins [BR:pop03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    7481744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 7481744
NCBI-ProteinID: XP_024439586
LinkDB All DBs
Position
13
AA seq 1086 aa AA seqDB search
MDCNRVLPDQPADEEEEEPEEEESRVSEVRSERSFDFAVKDEERQDRLALGDYRSLWSEF
DDFVANEDNGAMTGTSRALIYGFEVGDMVWGKVKSHPRWPGHIFNEAFASSSVRRTRREG
HVLVAFFGDSSYGWFDPAELIQFDVNFAEKSQQTNSRTFIKAVEEATDEASRRSALGLAC
KCRNKYNFRPANVPGYYVVDVSDYEPGGVYSASQIMKARDGFKPGETLAFVKQLAVGPHG
CDQESFEFIKNKARAFAFRNAVFEEFDETYAQAFAVQSSRPSNDTAKVPNQLAKEPTRAP
LSGPLVIAEAPGGEKSSKKPIKVKDHSKKGNYLLKRRDEPSELRAFEIVQRQAGSSSLAV
YVEAGSSAVEAGDFVLQKRASTPHISAKHEQSVLITKEDVDSSEDGAGKAALVLDHAPGD
ANVSLDKKGAMQEIEGEPGSDVAVGLMSTGWSDLPGKEQLKGVSDCTYEESAKASGSNQV
SQQNELSFSARAEVDSGLSKLQDGEPGSLLSPLNATQSVGTSTGSGVKKVKVIKRPVGDT
SSQKSIMGGKRKKEIRAETNPDRPKKRLATGKGEEVRISLGKSTHISFSPGEDSQLNSQK
KDGIEFELPQLLSDFLALALDPFHVAERNSHSVTMHFFLRFRSLVFQKSLVLSPPSETEV
VEVRGTKSLSSIGASDYSASEDTRGLIPSKPAKLLVRPNDPTKAGRKRLPSDRQEEIAAK
RQKKIIQLKSLAAEKKAQRTLDTLGAEGKETVARQRAEGKQTAATQRVEGKQPVAQPPRK
SVKPDSFKKMEPPVRAIEPTMLVLRFPPETSLPSAAQLKARFARFGSIDQSAIRVFWKSS
QCRVVFRRKLDAQAALKYALGNKSLFGDVNVRYNIREVGAPASEPPESDKSRDDTFVDAA
QAEDPLADWQAVAFAHQPPSQSTVQLKSILKRPNGDEAAPVTGGNGSRGNRVKFMLGGEE
TNSGEQMMVGNRNNFNNNASFADGDAPTTSVAMGFSSKNIQKVFPPSPLPILPLPTQFAK
APLNYSQHHTEVAPRNSHNFNTPPPSAGPSTPSIDISQQMLSLLTTCNDVVTSVSGLLGY
VPYHPL
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atggattgcaaccgggttttgccggatcaacccgccgatgaagaagaggaagaaccagaa
gaagaagaatctagggtttctgaagtgagaagtgaaagaagttttgattttgctgttaaa
gatgaagagaggcaagataggttagcgttaggagattatagatctttatggagtgaattt
gatgattttgttgctaacgaggataatggagcaatgactggtacgtctagggcattgatt
tatggttttgaagtcggtgatatggtttgggggaaagtgaaatcgcatccgcggtggccg
gggcatatatttaatgaggcgtttgcttcctcgtcagtaaggcggacgaggagggaaggt
catgtgttggttgcttttttcggggatagtagttatggttggtttgatccggcggagctt
attcagtttgatgtgaatttcgcagagaaatcgcagcaaacaaattccaggactttcatt
aaggcagtggaggaggcaacggatgaggcgagtaggaggagtgcacttggcttggcttgt
aagtgtaggaataagtataattttaggcctgcaaatgtgccagggtattatgtggtggat
gtgtcggattatgagcctggaggggtttattcggcgagtcagattatgaaggcaagagat
gggtttaagccgggggagactcttgcttttgtgaagcagttggctgtcgggcctcatgga
tgtgatcaggagagttttgaatttattaagaataaggcgagggcttttgcttttcgcaat
gctgtttttgaagagtttgatgagacctatgcacaggcatttgcagttcagagttcacgg
ccttctaatgataccgctaaggtaccaaatcagcttgctaaagagccaactcgagctcct
ttgagtggtccattggtgatagctgaagctccgggtggcgagaagagctcaaaaaaacct
ataaaagtcaaggaccattcaaaaaaaggcaattatctccttaagcgaagagatgagcca
agtgagctgagagcttttgaaattgtccaaaggcaagcaggttcctcatccctagcagtt
tatgtggaggctggttcatcagcagtggaagctggtgattttgtgttgcagaaaagagct
tcaaccccccatatttcagcaaaacatgagcagtctgtgcttataaccaaagaagatgtg
gattctagtgaagatggagctggcaaagcagcgttagtcttagatcatgctccaggagat
gcaaatgtgtctcttgataagaagggtgctatgcaagaaatagaaggtgaaccaggatca
gatgtggctgtgggtctgatgagtacagggtggtctgacttacctgggaaggagcagctt
aagggtgtgtcagattgtacatatgaagagagtgcaaaagcatcaggatcaaatcaagtt
tctcagcaaaatgaactgagcttttctgcaagagcagaggtagacagtggattgagtaaa
cttcaggatggtgagccaggttcacttctttcaccacttaatgccacacaatctgttgga
acaagtacaggtagtggagtaaaaaaggtcaaagtcattaaacggcctgttggggacacc
agttcgcagaagtctattatgggggggaaaaggaagaaagagatacgagcagaaactaat
cctgatcgtccaaagaagcgattggccactggaaaaggtgaggaagtgagaatctcatta
ggaaaatccacccatatcagtttttctcctggagaggattctcagcttaacagtcaaaag
aaagatggtattgagttcgagctaccacagctacttagtgatttccttgctctagctctc
gatcctttccatgttgcagaaagaaatagccattcagttacaatgcatttcttcttgcga
ttccggtccctcgttttccagaaaagcttggttttgtcaccaccatccgagactgaggtt
gttgaagttcgtggcactaaatccttgtccagtattggggcttctgactattctgccagt
gaggacaccagaggtttgataccttcaaaaccagcaaaactccttgtcagacctaatgat
ccaacaaaagctggacggaagcgtttgccatctgatcgccaggaagaaattgcagcaaaa
aggcaaaaaaaaattattcagttgaagtcattggctgcagagaagaaggctcagagaact
ttggatacgcttggagctgaagggaaagaaacagtggctaggcagcgagcagaagggaaa
cagactgctgctacccaacgggtggaaggaaaacagccagtggcgcaacctccacgaaag
tcagtcaaaccagattctttcaaaaaaatggagcctccagttagagctattgagcccact
atgttggtgctgaggttccctcctgagacatctcttccatctgccgcgcagctgaaggca
aggtttgctcgatttgggtcaatagatcagtctgcaatccgtgtcttttggaagtcatca
caatgccgtgttgtgtttcgtcgaaagcttgatgcacaggcagctcttaaatatgctctt
gggaacaaatccttgtttggcgatgtgaatgtaaggtacaacattcgtgaagtaggagct
cctgcttcagagccacccgaatctgacaagagcagagatgacacttttgttgatgcagca
caggctgaggatcctcttgctgattggcaagctgtagcatttgcacaccaacctccttca
cagtcaacagtacagctgaaatctatattgaagagaccaaacggtgatgaagcagcacca
gtaactggtggtaatggtagtagaggaaatcgtgtaaaattcatgttgggtggggaggaa
actaatagtggagagcaaatgatggttggtaatagaaacaacttcaacaacaatgctagt
tttgctgatggtgatgcacccactacttctgttgctatgggttttagtagtaagaacatt
caaaaggtttttcctccatctccattgcctattcttcccctccctactcaatttgcaaaa
gccccacttaattattcacaacatcataccgaagtagcacccagaaactcgcacaatttc
aacacccctcctccaagtgccggacccagtacaccaagcatagatatttcgcagcagatg
ctgagccttttgaccacttgcaacgatgttgtcacctccgtgtcaggcttgttaggctat
gtgccttaccaccctctttga

DBGET integrated database retrieval system