KEGG   Populus trichocarpa (black cottonwood): 7482338Help
Entry
7482338           CDS       T01077                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop00051  Fructose and mannose metabolism
pop00052  Galactose metabolism
pop00500  Starch and sucrose metabolism
pop00520  Amino sugar and nucleotide sugar metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Module
pop_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7482338
   00051 Fructose and mannose metabolism
    7482338
   00052 Galactose metabolism
    7482338
   00500 Starch and sucrose metabolism
    7482338
   00520 Amino sugar and nucleotide sugar metabolism
    7482338
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    7482338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pop04131]
    7482338
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     7482338
Membrane trafficking [BR:pop04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    7482338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 7482338
NCBI-ProteinID: XP_002313358
UniProt: B9HP03
LinkDB All DBs
Position
9
AA seq 508 aa AA seqDB search
MGKLAAGLAAAAAVAACAVAGVVVGRRVRSRRKWKRVVGVLRELEEACETPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVDHLPTGSEIGTYYALDLGGTNFRVLRVQLGGRRSS
ILSQDVERRPIPRHLMTSTSEDLFDFIASTLKQFVEKEESGSEPSSVRARELGLTFSFPV
KQLSIRSGILMKWTKGFAIEDMVGKEVVGLLEAALVRSGLDMRVAVLVNDTAGTLALGHY
DDADTVAAVIIGTGTNACYLERADAIIKCQGLLTTSGCMVVNMEWGNFWSSHLPRTSYDI
DLDLESPNPNDQGFEKMISGMYLGDIVRRVILRMSQDSDIFGPVSSRLSIPFILQTPLLA
AMHEDDSPELKEVDKILKETLEISEVSLKVRKLVVRVCDVVTRRAARLAAAGIVGILKKI
GRDGSGGVTGGRSRSDVKMRRTVVAIEGGLYTSYTMFREYLHEALNEILGEDVAHHVILK
VTEDGSGTGGALLAAAYSSGSVDNVQSL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggggaagttggcggcgggattggcggcggctgcggcggtggcggcttgtgcggtggca
ggagtggtggtggggaggagggtacggagtaggaggaagtggaagagagtggtaggagtg
ttgagagagttagaagaagcatgcgagacaccagttgggaggttaaggcaagtagtggat
gctatggctgtggagatgcacgctggtttggcgtctgaaggtggctcgaagcttaaaatg
ttactcacttttgttgaccatttgcctacggggagtgagataggaacttattatgctcta
gatcttgggggtactaattttagggtcttgcgggttcagctaggaggtagaagatcttca
atcttgtctcaagatgtggagcgacgacccattccccggcacttgatgacaagcacaagt
gaggatctctttgattttattgcttcaaccttaaagcaattcgttgaaaaagaagaaagt
ggttctgagccttcttcagttagagcaagggagcttgggcttacattttcttttccagtg
aaacaattgtctattcgttcaggtatccttatgaaatggacaaaaggatttgccattgaa
gatatggttggaaaagaggtggttggacttttagaagcagcattagtcaggagtggttta
gatatgcgcgttgcagtattggtaaatgatactgcgggaaccttagcacttggacattat
gatgatgctgacactgttgctgctgtgataattggaacgggtactaatgcctgttatcta
gagcgggcagatgccatcataaagtgtcaaggtcttcttacaacttcgggatgcatggtt
gttaacatggaatggggaaatttttggtcatcccatttgccaagaacttcttatgatatt
gatttggatttggaaagccctaacccaaatgatcagggttttgagaaaatgatatcagga
atgtatctaggtgacattgttcggagagttattctaagaatgtcgcaagactcggatata
tttggacctgtttcctccagattatcaatcccctttattttgcaaacacctttgctggct
gcaatgcatgaggacgactctcctgaactgaaagaagtagataagatcttgaaagaaacc
ctggagatttcagaggtctctttgaaggtccgaaagcttgttgtaagagtatgtgacgtt
gtgacccgtagggctgctcgattggcagctgctggcatagtgggaatcttgaagaagatc
ggacgggatggaagtggaggcgtcactggtggaagaagtagaagtgatgtaaaaatgaga
agaacagttgttgcgattgaagggggtttatatacaagttatacaatgttcagagagtac
ttgcatgaagccctgaatgaaatattgggagaagatgtggcccaccatgtcattcttaaa
gttacagaagatggatcaggcactggcggagctctccttgctgccgcatattcatccggc
agtgtggataacgtacagtcgctataa

DBGET integrated database retrieval system