KEGG   Populus trichocarpa (black cottonwood): 7484447Help
Entry
7484447           CDS       T01077                                 

Definition
(RefSeq) lysine-specific demethylase REF6
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN zf-C2H2 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 7484447
NCBI-ProteinID: XP_024438277
LinkDB All DBs
Position
12
AA seq 1685 aa AA seqDB search
MAAPSGLSPEPPQPPTSTEVCQWLKNLPLAPEYRPTQAEFQDPIAYIFKIEKEASQYGIC
KIIPPVLPSAKKTTLSNLNRSLSARNGDSSAPTFTTRQQQIGFCPRKPRPVQKPVWQSGE
TYTFQEFETKAKSFEKNYLKKFSKKGGLSPLEIENLYWKATLDKPFAVEYANDMPGSAFS
PRKKEGQGGVVGEGMYVGETEWNMRSVSRAKGSLLRFMKEEIPGVTSPMVYIGMIFSWFA
WHVEDHDLHSLNYMHMGAGKTWYGVPREAAVAFEEVVRVHGYGGENNPLVTFAVLGEKTT
VMSPEVFISAGVPCCRLVQNAGEFVVTFPRAYHSGFSHGFNCGEAANIATPEWLTVAKDA
AIRRASINYPPMVSHFQLLYDLALEFCTRIPVNISAKPRSSRLKDKQKGEGETLVKEQFV
KNMMQNNDLLHILGKGSSVVLLPRSSSDISVCSNLRVGSQLRDNPTLGLSSQKDFMKSSK
SSGSDDILMDENQEINQVKGFFSVKAKFASLCERNRFSTINGNECTQSMNMSTERGSPIH
GDKLSDQRLFSCVTCGILSFDCLAIIQPKEAASRYLMSADCSFFNDWVVGSGVTRDVFTV
AGGIANIPEQNSSMRWVRKNTVAGLYDVPVQSLNYQIQMADQSVEVASSSAKQMESSALG
LLALNYGNSSDSEDDQVEAGLSCHDETNFTNCSLESKYQGQSSACPSYKQKYYDAETGGH
PLSPSKHDQRGDVPFKAIDMYPEHGDRPDNFKDRSDDTLGCSFGFPANNPACIESNGLDG
RYRDPVSIPHMSLNCSPIVHDTEKTKFNRPTVPIENPDMPFTQRSDRDSSCLHVFCLEHA
VEIEQQLRQIGGVHIFLLCHPEYPRIEAEAKSVSEELGIDHLWNDITFRDAAKEDEERIQ
SALDTEEAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSVIYNAFGRASPVSSPPK
FKVYGRRSGKPKKVVAGKWCGKVWMSNQVHPFLVKRDFVYQNQEQEQERSFHALATPDEK
LEKKPQTIHRNETSRKSGRKRKIIAGSRTVKKVKCLEAEEADSEDSVGDNSHRQHMRIHN
RKNTEDIEREISYDLVEDSNQQHGSYRRKWAKSVESDDAVSDDPLAEHVRQQYRRMRRSK
QAKSIKRENTVSYASVENKFRKQLRRVHRSDQAKCSERRCVASDDSLDDNSDQWHGRAPR
STLAKYTEREDANSDDSPEESSRWQHGRVSRSKLLRYVKKESAISDDSLENGFKQHNKRI
SRGKRAQVIKRDDVVSDDSLDESAFQQLPRFSRIKLAKLIEREDAFSDGSLEENIHQQHG
RILRSKQSKFVEREDAISDDSLEDSTHWQHRRIPRSKMAKFVESEDAASDDLQEDDGHQH
HRRIPKRKKANSIESEDVVSDDLWQNNIHRHLRKTPRGKQPNIVEREEAVSDDLLENSSD
QQDRIILRSKQKKSSMKQGIPRQLKQSAPKMIKKETPQLMKQERQIKPETPQLRFGKSDM
NARQFDSHAEEERGGPRMRLRKRLSKAPKQSLTRLKEKQNIKKKVKDATAVKAPAGRKNV
KMKDEEAEYQCDIDGCRMSFVSKQELALHKRNICPVKGCGKKFFSHKYLVQHRRVHIDDR
PLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEEGCGQTFRFVSDFSRHKRKTGHLA
KKGRG
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccaagtgggttaagtccagaaccaccacaaccaccaacaagtacagaagta
tgtcaatggctaaagaacttacctttagcacctgaataccgtccaacacaagctgaattc
caagatccaattgcttacattttcaaaattgaaaaagaagcttctcaatatggaatctgc
aaaattatccctcctgtcttaccctctgctaaaaaaaccactctttccaacctcaaccgc
tctctctccgcccgtaacggtgactcttctgcccccacattcaccacacggcagcagcag
atcggattctgccccaggaaacctcgccctgttcaaaaaccagtgtggcagagcggtgag
acctacacatttcaagaatttgaaaccaaggctaaaagctttgagaagaattatttgaag
aagttctctaagaagggaggtctttctccattagaaattgaaaacctttattggaaagct
actttagataagccttttgctgtagaatatgctaatgatatgcctggttctgcgttttcg
ccgaggaaaaaggagggacaaggaggggttgttggggagggaatgtatgtgggggaaact
gagtggaatatgaggagtgtttcaagggctaaagggtccctgttgaggtttatgaaggag
gaaataccaggggttacttcgcctatggtttatattgggatgatatttagttggtttgct
tggcatgttgaggatcatgatttgcatagcttgaattatatgcatatgggtgctgggaag
acttggtatggtgtgcctagagaggctgctgtcgcatttgaggaagttgttagggttcat
gggtatggtggagagaataatcctcttgttacatttgctgttctcggtgagaagacgaca
gtaatgtcacctgaagtatttatcagtgcaggtgtaccatgctgcaggttagttcaaaat
gccggggagtttgtggtcactttcccaagagcctatcattcagggttcagtcatggattc
aactgtggggaggcagccaatattgctacacctgaatggttgacagttgctaaagatgct
gctattcgaagagcttcaatcaattaccctcctatggtgtctcatttccagttactttat
gatcttgctcttgaattttgtacaagaatacctgtgaacatcagtgctaaaccacggagt
tcaagactgaaagataagcaaaagggtgaaggagaaacactggttaaagagcaatttgtg
aagaatatgatgcagaataatgacctgcttcatattcttggaaaaggatcttcagtggtg
cttcttccacgaagttcttcagacatttctgtttgttcaaacttacgagttggatcccag
ctaagagataaccccacccttggattaagcagccagaaggattttatgaaatcctcaaaa
agctcaggttctgatgacatcttgatggacgagaaccaggaaattaatcaagtgaaaggc
ttcttttcagtgaaagcgaagtttgcttctttgtgtgaaaggaataggttctccacaata
aacggaaatgaatgcacacagagtatgaacatgagtactgaaagaggtagccccattcat
ggtgataagctgtcagatcagagactgttttcatgcgtcacatgtggaattttgagcttt
gattgtcttgccatcattcaaccgaaagaggcagcttctagatacctcatgtcagctgat
tgtagtttctttaatgattgggtcgttggttctggagtaactagggatgtttttactgtt
gctggtgggattgcaaatattcctgagcagaattcctcaatgagatgggtgagaaagaat
accgtggctggtttatatgatgtccctgttcaatctcttaattaccaaattcagatggca
gatcaaagtgttgaagtggcttccagttctgcaaaacagatggagtcttctgctcttggc
ctattagctttgaattatggaaattcgtctgattctgaggatgatcaggttgaagcaggt
ctatcttgccatgatgaaactaacttcacaaactgttcattagaaagcaaatatcagggt
cagagttctgcttgcccttcttacaagcagaagtactatgatgctgaaactggtggtcac
cctctatctccatcaaaacatgatcagcggggtgatgttcctttcaaagctattgatatg
tatccagaacatggagataggccagataatttcaaggatagaagtgatgatactcttgga
tgttcttttggattcccagccaataaccctgcttgcattgaatcaaatggtttggatggt
agatacagagatccggtttcaataccacacatgtctttaaattgttccccaattgtccat
gatactgaaaaaacaaagtttaacaggcctactgtaccaatagagaatccagatatgcca
tttacccaaagatctgatagagactcttcgtgcttgcacgtgttctgtcttgagcatgct
gtagaaatagaacaacaacttcgtcaaatcggtggagtacatatattccttctttgccat
ccagagtatcccaggattgaagcagaagcaaagtcagtgtcagaagaattgggaattgat
catctatggaatgacattactttcagagatgctgccaaagaggatgaggagaggatccag
tcagctttggatactgaggaagccataccagggaatggggactgggctgtaaagttgggg
atcaatcttttttacagtgccaacctcagccgatctcctctttatagtaagcagatgcca
tacaattcagttatatacaatgcctttggtcgtgcttctccagttagttcacccccaaaa
tttaaggtttatggaaggagatctgggaagccaaaaaaagttgtggcagggaaatggtgt
ggaaaagtttggatgtcaaatcaagttcatccctttctagtgaaaagggattttgtatat
caaaatcaagaacaagaacaagaaagaagcttccatgctttggccactcctgatgaaaag
cttgagaaaaaaccacaaaccatccacagaaatgaaaccagtagaaaatctgggaggaag
aggaaaataatagcagggagcaggactgttaagaaagttaagtgtctggaagcagaagaa
gcagattcagaagactcggtgggggataattctcataggcagcatatgagaattcacaat
aggaaaaacactgaagacattgagagagagatttcatatgatctagtagaggatagcaat
cagcagcatgggagctacagacgcaaatgggccaaatctgttgagagtgatgatgcagtt
tcagatgatccattagctgaacatgttcgtcagcagtataggagaatgcgtagaagcaag
caagccaaatctatcaagagggaaaatacagtttcttatgcttcagtggagaacaagttt
cgaaagcagcttaggagagttcatagaagcgaccaagccaaatgttctgagagacgatgt
gtagcttctgatgactcactggacgataacagtgatcagtggcatgggagagctccaaga
agcacactagcaaaatatactgagagggaagatgcaaattcagatgattcaccagaggag
agttctcgttggcaacatgggagagtttctaggagcaaacttttgagatatgtcaaaaag
gaaagtgcaatttcagatgattcattggagaatggctttaaacagcacaacaagaggata
tcaagaggcaagcgagcccaggtcattaaaagggatgatgtggtttccgatgattcattg
gatgaaagtgcatttcagcagctcccgagattttctaggatcaagctagccaaattaatt
gagagggaagatgcattttcagatggttcgttggaggaaaatatccatcagcagcatgga
aggattcttagaagcaagcaatccaaatttgttgaaagggaagatgcaatttcagatgat
tctcttgaggacagtactcactggcagcacagaagaattcctagaagcaaaatggccaaa
tttgtcgagagtgaagatgcagcttcagatgatttgcaggaggatgatggtcatcagcat
cacagaagaattccaaaacgcaaaaaggccaactctattgagagtgaagatgtagtttct
gatgatctgtggcagaataatattcatcggcaccttaggaagactcctagaggcaagcaa
cccaatatagtggagagggaagaagctgtttcagatgacttactggagaatagttctgat
cagcaggacaggattattcttcgaagcaagcagaagaaatcttcaatgaaacaagggatt
cctcggcaactgaaacagagtgcccctaagatgataaaaaaagagaccccacaattaatg
aaacaagagagacaaataaagccagaaactcctcagcttcggtttggtaaaagtgatatg
aatgctagacagtttgattcacatgctgaagaggagcgaggtggacctcgcatgcgcctc
aggaaaagactctcaaaggctccaaaacagtcgttaacaaggctgaaagagaagcagaac
atcaagaaaaaagtgaaggatgctacagcagtgaaggctccagctgggcgaaagaatgtt
aaaatgaaagacgaggaggcagaatatcagtgtgacattgacgggtgcagaatgagtttt
gtatcgaaacaggagcttgcactgcacaaaagaaacatttgtccagtcaaggggtgtgga
aagaagtttttctcgcacaaatatctggtgcagcatcgccgagtccatatagatgaccgc
cctctcaagtgcccttggaagggatgcaagatgacattcaagtgggcatgggcccggacc
gaacatatcagggttcacacaggtgctcgtccttatgtatgtgctgaggaaggctgtggc
cagacattcagatttgtgtcagatttcagtcgtcacaagcggaagactggtcatttggca
aagaaaggccgggggtaa

DBGET integrated database retrieval system