KEGG   Populus trichocarpa (black cottonwood): 7484749Help
Entry
7484749           CDS       T01077                                 

Definition
(RefSeq) isochorismate synthase, chloroplastic isoform X1
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00130  Ubiquinone and other terpenoid-quinone biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    7484749
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    7484749
Enzymes [BR:pop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     7484749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-GeneID: 7484749
NCBI-ProteinID: XP_024437929
LinkDB All DBs
Position
12
AA seq 572 aa AA seqDB search
MATATLARHSLAHFMDLESIKYSIAAQPVSRRQSLHLFYHRCYYHKPCSVVVSMNGCQGN
PRGRVPIGSIETRTFPAVTSPALATDTLNLAISELKANPPLFTSGILRLQVPIQQQIEAI
DWLHSQHQIHPRCFFSGRRQSKDFTEVTNGNGYQKSNNVVSVAGVGSAVLFRDVHPFCYN
DWKSIKRFLSANCPLIRAYGAIRFDARANISSEWEPFGSFYFVIPQVELDELDGCSMLAT
TIAWDNAFSWTWEQAVDAVEATMTQISSNVLKLSKEVTRSFILSNSHVPCKMYWDLAVER
ALQIINRSSSPLTKVVLARSSKFVIGNDIDPIAWLACLQVEGENAYQFCLQPPNAPAFIG
NTPEQLFHRNCLGISSEAMAGTRVRGGSMALDLQIQLDLLSSPKDHLEFTIVRDNIRKKL
EAVCDRIVVEPNKAIRKFHRVQHLYARLAGELRSEDDEFKILSSLHPTPAVCGFPTEEAR
LLIAETEVFDRGMYAGPVGWFGGGESEFAVGIRSALAEKGLGALIYAGTGIVKGSNPSLE
WDELELKTSQFTKLLKLEGPSRQKIENSGIIN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgctactctagcaaggcacagccttgcacattttatggatttggaatcaatt
aagtacagtatcgcagcccaaccagtttccagaaggcaatctcttcatcttttctaccac
agatgctattatcacaagccatgttcagtggttgtatccatgaatggctgccaaggaaac
cccagaggcagagtccctattggcagcatcgagactcgtacatttccagcagttacatct
cctgctttggctacggacaccctcaatttggcgatttctgaattgaaagccaatcctcct
cttttcacttcaggaatcttacgtctccaggtgccaatccaacagcaaattgaagcaatt
gattggctacactctcagcaccagattcatccacgctgtttcttctctggtcgaagacaa
agcaaagatttcacggaggtaaccaacggaaatggctatcaaaagtccaataatgtggtc
agtgtggctggtgtgggctctgctgtccttttcagggatgtccatccattttgttacaat
gactggaagtccataaagaggttcctctctgccaattgtccactgattcgtgcttatgga
gctatccgctttgatgcaagggctaacatatcatctgaatgggaaccttttggctcattt
tacttcgttatccctcaggttgagttggacgagctagatgggtgttccatgctcgccaca
actattgcatgggataatgcattttcatggacatgggaacaggctgtggatgctgttgaa
gctaccatgactcagatctcttcaaatgtgttaaagttaagtaaagaagtaactagatca
ttcattttaagcaatagtcacgttccctgcaagatgtactgggatcttgctgttgagaga
gctttgcaaatcatcaatcgaagcagctcaccacttactaaggttgtactcgcacgtagt
agcaaatttgtaattggtaatgacatcgatcctatagcatggttggcttgcctgcaggtt
gaaggggaaaatgcttatcaattttgtcttcagccgcccaatgcccctgcatttattggg
aacacgccagagcaactatttcacagaaattgcctgggaataagtagtgaggctatggct
ggaacccgtgttcgaggtggatccatggctttagatcttcaaatacaacttgatttactt
tccagtcccaaggaccacctcgagtttacgatagtacgagataacataagaaaaaaatta
gaggctgtatgtgacaggatagttgttgaaccaaacaaagctataagaaaattccataga
gttcaacacttgtatgcacgattggcaggcgagttaagaagcgaagatgatgagtttaaa
atcctgtcgtctcttcaccctactccagcagtttgtggatttccaacagaagaggctcga
cttttaatcgcagaaactgaagtatttgatcgagggatgtatgctgggcctgttggttgg
tttggaggaggagaaagtgagtttgctgttggcattagatcagcattggcagaaaagggt
cttggtgcattgatctatgccgggacggggatagtaaaaggaagcaacccatctttggaa
tgggatgaactggaattaaagacatctcagtttaccaagctgcttaaacttgagggtcca
tcaagacaaaaaatagagaactcaggaatcatcaactga

DBGET integrated database retrieval system