KEGG   Populus trichocarpa (black cottonwood): 7489351Help
Entry
7489351           CDS       T01077                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop00020  Citrate cycle (TCA cycle)
pop00620  Pyruvate metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Module
pop_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7489351
   00020 Citrate cycle (TCA cycle)
    7489351
   00620 Pyruvate metabolism
    7489351
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     7489351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 7489351
NCBI-ProteinID: XP_024466981
LinkDB All DBs
Position
10
AA seq 475 aa AA seqDB search
MASSPFLSRIPINNKTISFSSSLSPSFPFSPSTLSHRKRNPNALRVQAKIREIFMPALSS
TMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGETAPVGAP
IGLLAETEEEIAEAKAKAASKAGGSSSPATPISPPDSSTPAPAIPQPPPAPAAPEGPRKT
VATPFAKKLARQHKVDINKVVGTGPYGRITPADVEAAAGIAVSKPSVSSASPAAAAAPVM
AAASSSAPPPLPGSNVVPFTSMQGAVSKNMVESLSVPTFRVGYPITTDALDALYEKVKPK
GVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNSNINIAVAVAINGGLITPVLQDADK
LDLYLLSKKWKELVEKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVG
ASKPTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIVENPESLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatctcccttcctctccagaatccccatcaacaacaaaaccatttccttctcc
tcctccctctccccttccttccctttctctccctccacactctcccaccgcaaaagaaat
ccaaatgccttgagagtccaagccaagatccgcgagatcttcatgcctgctctcagctct
accatgaccgagggcaagatcgtgtcctggattaaatccgaaggagatgttctctctaaa
ggcgaaagcgtcgtcgtggttgaatccgataaagctgacatggatgtcgagaccttctac
gacggcattctcgccgcaattgtagttcccgagggtgaaaccgctccagttggcgctcca
attggacttttagctgaaactgaagaggaaattgcggaagccaaggcgaaagctgcctcc
aaagctggtggttcgagttcacctgctactcccatttctcctcctgattcttccactccc
gctcctgcaattccgcaaccacctcctgctccggctgcacctgagggaccgaggaagacg
gttgccacgccgtttgcgaagaaattggctaggcagcataaggtggatattaataaagtg
gttggaacggggccgtatggacggataactcctgctgacgtggaggcagctgcgggaatt
gctgtatcaaagccgagtgtgagttcagcttcccctgctgccgctgctgcgccagttatg
gctgcagctagttcctcggctcctcctccgctaccggggtctaatgttgtgccatttact
tcaatgcaaggggctgtttcaaagaatatggtggagagcctttccgttccaacttttagg
gttgggtatccaatcacaactgatgctcttgatgcattatacgagaaggttaaaccgaag
ggtgtgacaatgactgcattgttggcaaaagctgcggcgatggcacttgttcagcaccca
gttgtgaatgcaagctgtaaagatgggaaaagctttacttataacagtaacattaacatt
gcagtagctgtggcaatcaatggtgggttgataacccctgttctgcaggatgcagataag
ttggatctatacttattatcaaaaaaatggaaagagttggtggagaaggcccgagcaaag
cagcttcagccccaggagtataattcagggactttcactctatccaatttaggaatgttt
ggagtggacagatttgatgccattcttcctccaggccagggggctatcatggctgttgga
gcatcaaaaccaaccgtggtggctgataaagatggattcttcagtgtgaaaagtaaaatg
ctggtgaatgtgacagctgatcaccgaatcgtctatggtgctgacttggctgccttcctc
cagacctttgctaagattgttgagaacccagaaagcctgacattataa

DBGET integrated database retrieval system