KEGG   Populus trichocarpa (black cottonwood): 7490205Help
Entry
7490205           CDS       T01077                                 

Definition
(RefSeq) protein SENSITIVE TO PROTON RHIZOTOXICITY 1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-met zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 CRIC_ras_sig RecR
Motif
Other DBs
NCBI-GeneID: 7490205
NCBI-ProteinID: XP_002310559
UniProt: B9HFF7
LinkDB All DBs
Position
7
AA seq 358 aa AA seqDB search
MSNPGESTRNPTGFSVPISNTDPRVPLLNLSAVRTRMDSLQQFLSESVNNNTLIGKDQMD
MVSSEISSAIHEIIVNAAALLSCNSSSSQPFTPQPPVDSTAIKKAQVLKVENKEEDSEVV
ELDAVELLAEHVHFCEICGKGFKRDANLRMHMRAHGNQFKTLEALAKPDKGNETISASFA
GKTKFSCPFEGCNRNKKHGKFKPLKSVICVRNHFKRSHCPKMYSCNRCNKKSFSVVTDLK
SHLKHCGESRWKCSCGTSFSRKDKLFGHMALFEGHMPAVAGEEEDSKAKEVGVGGAVDME
EDEEEESVVKGDNLGGDCNDNEFFEGLLDGFCSMEGYSLQDVLGSPFSGIEEFSGLRH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcccggcgaatctacccgaaatccgacgggattttccgtcccaataagtaac
acagaccctcgagtcccactcctgaacctctcagctgtccgtacgagaatggattcactt
cagcaattcctatcagaatcagtcaacaacaacactttaatcggaaaggatcagatggac
atggtctcttccgagatctcctcagccatacatgaaatcattgtcaacgctgctgctctt
ctctcttgtaacagcagtagctcacaaccctttacgcctcagccgccggtggatagtact
gcaataaaaaaggcccaagttttgaaagtagaaaataaagaagaggacagtgaagtcgta
gaacttgatgcggtagaattgctcgccgagcatgttcatttttgtgagatttgcggaaaa
gggtttaaaagagatgcgaatttgcgtatgcatatgcgtgcgcatgggaatcagttcaaa
acccttgaggcactagctaagcctgataagggtaatgaaacgatatcagcttcctttgcg
gggaagacaaagttttcttgcccttttgaaggttgtaataggaataagaaacatggtaag
ttcaagccattgaagtcggtgatttgtgtaagaaatcattttaagaggagtcattgtccg
aagatgtattcttgtaatcggtgcaacaagaagagtttttcggttgttacggatctgaag
agtcatttgaaacattgtggggagtcgagatggaagtgttcttgcgggacaagtttttcg
aggaaggataagttgtttggtcatatggctttgtttgaaggacacatgcctgctgttgct
ggtgaagaggaggatagtaaggccaaggaggtgggagttggcggcgcggtggatatggag
gaggatgaagaagaagaatcggttgtaaagggagataatttgggtggggattgtaatgat
aatgagttttttgagggattgcttgatgggttttgttccatggaggggtatagcttgcag
gatgtattggggtctccttttagtggaatcgaggagttttctggtctcaggcattga

DBGET integrated database retrieval system