KEGG   Populus trichocarpa (black cottonwood): 7490219Help
Entry
7490219           CDS       T01077                                 

Definition
(RefSeq) rho GTPase-activating protein gacJ
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: VQ X
Motif
Other DBs
NCBI-GeneID: 7490219
NCBI-ProteinID: XP_024461410
LinkDB All DBs
Position
7
AA seq 506 aa AA seqDB search
MDSGNSGSMQSSSGGDEEYDSRAESISAFLNNNNNPLSHVGPMSSNPPPQPEHHHHHQTH
HSSSSSTMLFDPLSNYFDPLSSASSRSPPPPFTNPNSLLNLDMVWSKNLRSEPNCTDLGG
FISSSSPTQQLFTNQTQTRTTFQSLPPHGHESATRGPVSGTNDQVSNTAGVRNPKKRSRA
SRRAPTTVLTTDTTNFRAMVQEFTGIPAPPFTSSPFPRSRLDLFGTAASTLRSAVSHHLD
PSPPPYLLRPFAQRFQPPPPPAPPFASSGSTASSFSTSMVDAIASTTTTNINNSGACTNS
TTTSNISSTSINYQLPSDLGLLKQPHHLLNINVQNPILNFHPLFQAPHKYPLPNSTNILG
TTKAQQGSSLEIPSNDSHLKMGVLEEFGMSHGHVSTNLTGLQNIVSSSSSPSADATLMRR
GDHNNNLANWGDGVGSNGGGHHHHQQQQGLLRSINGNYNNSTQRVTNGKVNFLASSSSDF
RGDNKGQENVATRSEGMMESWICSSD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggattctggcaatagtggaagtatgcaatcctccagtggtggagatgaagagtatgat
tcacgcgctgagtcaatctcagctttcttgaacaacaataacaacccattaagccatgtt
ggtcccatgtctagtaacccaccaccacaaccagaacaccaccaccaccaccaaacccac
cactcttcttcatcatcaacgatgttgtttgaccctttatcaaactattttgatccttta
tcatcagcatcatcaagatcaccaccacctcctttcacgaacccaaactcactcctcaat
cttgatatggtttggtctaagaacttaagatctgaacccaattgcactgatcttggtggc
ttcatttcgtcttcctcaccaacccaacagttgtttaccaaccaaactcaaactagaacc
acttttcagtctctaccaccacatggacatgaaagtgctacaagaggtccagtttcaggg
acaaatgatcaagtcagtaacactgcaggggttagaaacccgaagaaaagatcaagagct
tctaggcgtgcaccaactactgtcttgaccacagacaccaccaatttcagagccatggtt
caggagtttacagggatccctgcaccacccttcacatcctcacctttcccaagaagcagg
cttgatctatttggaactgcagcctccactttgagatcagctgtctctcaccatttggac
ccttcaccgcctccttaccttttaagaccgtttgctcaaagattccaaccacctccaccg
ccagcaccaccatttgcctcttcaggctctactgcatcatcattttctacttctatggtt
gatgctatagcctccactactacaactaacatcaacaattccggtgcttgtactaatagt
actactacttctaatatctcctcaacttccattaactaccaactaccttctgatttaggc
cttttgaaacagccgcaccacttgctcaacatcaacgtccaaaacccaattctcaatttc
caccctctttttcaagcccctcacaaatatccacttccaaattcaaccaatatccttggc
accacaaaagcacaacaagggtcttctttagaaatcccatcaaatgattcacatctcaaa
atgggtgttttagaagagttcgggatgagccatggccatgttagcacaaaccttacaggg
cttcaaaatatagtttcatcatcatcgtcaccatcagcagatgcgacgttaatgagaaga
ggtgatcacaacaacaatcttgcaaactggggagatggggttggttcaaatgggggtggc
catcatcatcatcaacaacaacaaggtcttctaaggtccattaatggcaattacaataac
tcaacccagcgtgttacaaacgggaaagttaacttcttggcttcatcatcatcagatttt
cgtggtgataataaggggcaagagaatgtggctacaagaagtgaaggtatgatggaatcg
tggatttgttcttctgattag

DBGET integrated database retrieval system