KEGG   Populus trichocarpa (black cottonwood): 7490333Help
Entry
7490333           CDS       T01077                                 

Definition
(RefSeq) anthranilate synthase alpha subunit 1, chloroplastic
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01230  Biosynthesis of amino acids
Module
pop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    7490333
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    7490333
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     7490333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 7490333
NCBI-ProteinID: XP_002316223
UniProt: B9HSQ4
LinkDB All DBs
Position
10
AA seq 580 aa AA seqDB search
MQTLIFSNCLSLASHRLCPVPVTGISTRRSSSVSCVRPLKCISLSSDSLVVDATKFKEAA
KNGNLVPLHTCIFSDQLTPVTAYRCLVKEDDRDAPSFLFESVEPGSRVSSVGRYSVVGAQ
PAIEIVAKEDKVSLMDHEAGTLIEEIVEDAMVVPRRISEAWKPQLIDGLPDAFCGGWVGY
FSYDTVRYTEKKKLPFSRAPKDDRNLPDIHLGLYDDVIVFDHVEKKAYIIHWVKIDRYSS
IEDAYSDGMKRLEKLLARVLDIDPPRLSPGSVKLHTQHFGPLLKNSNMTSDEYKQAVLRA
KEHIQAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQARGCILVASSPEIL
TRVKNNRVVNRPLAGTVRRGKTPEEDEVLEEQLLKDPKQCAEHTMLVDLGRNDVGKVSKH
GSVKVERLMNVERYSHVMHISSTVTGELHDHLTCWDALRAALPVGTVSGAPKVKAMELID
QMEVSRRGPYSGGLGGVSFTGDMDIALALRTMVFPTGTQYNTMYSYKDAQLRREWIAYLQ
AGAGIVADSVPDDEHRECQNKAAGLARAIDLAESTFVNKP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctaatcttctctaactgcttgtctctggccagtcaccggctctgtccagtc
ccggtcaccggcatttcaacgaggaggtccagttcagtctcgtgtgtccgtccactcaag
tgcatttccctttccagtgattctctagtagttgatgccaccaagttcaaggaagctgct
aaaaatggaaatttggtacctcttcacacctgtatattctctgaccagctcactccagtc
actgcttatcggtgtttggtgaaagaagatgatagagatgctcctagctttctatttgag
tccgtggagcctggttctcgggtttcaagtgtggggcgttacagtgtggttggagctcaa
ccagcaattgagattgtagcaaaagaagataaggttagtctgatggaccatgaagccggt
acattgattgaggagattgtcgaagatgcgatggtggttccaagaagaatatcagaggct
tggaaaccccaactcattgatggacttccagacgcattttgtggtggctgggttggttat
ttctcatatgacactgttcgatacacggagaagaaaaagctgccattttcaagggcaccc
aaggatgacaggaatcttccagacatacatctgggactttatgatgatgtgatcgtgttt
gatcatgtggaaaagaaagcatacataattcactgggtgaagatagatagatactcttct
attgaggatgcatacagtgatggaatgaaacgtttggaaaaattgttggccagagtactg
gatattgatccgccaaggctatctccaggttctgtaaaattacacactcagcattttggt
cccttgttgaagaactcgaacatgaccagtgatgaatacaagcaagcagtactacgggca
aaagaacatatccaggctggggatattttccagatagtactgagtcagcgctttgaacgc
cgaacctttgctgacccatttgaaatatatagagcattgagagtcgtaaatcccagtcct
tacatgacttacttgcaagctagagggtgtattcttgttgcttcaagtccagaaattctt
acacgtgtaaagaataatagggtagtcaatcggccactggctgggactgtcagaagaggt
aagacacctgaagaagatgaagtgttggaggaacaattactaaaggatccaaagcagtgt
gcagaacataccatgcttgttgatttgggaagaaatgatgttggaaaggtttcaaaacat
ggctctgtgaaggtggaaaggcttatgaatgttgaacgatattcccatgttatgcacata
agctccacggtcacgggagagttgcatgatcatctcacttgctgggatgccctgcgtgct
gcattgcctgttggaactgtcagtggagcaccaaaggtgaaggcaatggaattgattgac
caaatggaggtgtcgaggcgtggcccatacagtggaggactaggtggggtttccttcact
ggtgatatggacattgcactggctcttaggaccatggtattcccaaccggaactcaatac
aacacaatgtactcatacaaggatgcccagctgcgccgtgaatggattgcttaccttcaa
gctggtgctggtatagttgcagacagtgtacctgacgatgagcatcgtgaatgccagaac
aaagctgctggacttgctcgtgccatcgacttggcagaatcaacttttgttaacaaacca
tga

DBGET integrated database retrieval system