KEGG   Populus trichocarpa (black cottonwood): 7491136Help
Entry
7491136           CDS       T01077                                 

Definition
(RefSeq) zinc finger CCCH domain-containing protein 24
  KO
K15332  tRNA (uracil-5-)-methyltransferase [EC:2.1.1.-]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pop03016]
    7491136
Enzymes [BR:pop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     7491136
Transfer RNA biogenesis [BR:pop03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    7491136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_U5-meth_tr Methyltransf_31 Methyltransf_25 zf-CCCH RRM_1 MTS Methyltransf_4 Ubie_methyltran Methyltransf_15 Methyltransf_11 PCMT Methyltransf_32 Torus PrmA PhaC_N SSP160 Ish1
Motif
Other DBs
NCBI-GeneID: 7491136
NCBI-ProteinID: XP_024464577
LinkDB All DBs
Position
9
AA seq 870 aa AA seqDB search
MASSSPKNQLSSSSETLNLPSETSLTQTNPMNAQDSPIPPEQQIQPSNNQDDTATTTGEK
RKREKTTTTTTEAETETETDPSLNPFHKTSLCSYFRRHMGASCSHGSACKYAHGEEELRP
RPDNTWDPTSERAKKAIKLDTTNNNDSKEEDEDEEIMMTDIAADGDGDGGCLDTGLSKCL
VHLPRKWLSDHLRKFLSDQGILFKSAKKKKGMSVGFLSFEDAEQLKKAIEELEGRSIGNK
NIKVADVIPRQFEQKIKSAMAAPQNIPQTMEPALDGENAGISRPSDAIGDGDGNNDNSTQ
DGSSSQAKCARDVATPLAHMPYDDQLEHKKNSIMQMLKKLTRNARKACPNGVSLPEWILK
SREIGGLPCELEGILESPLRNGYRNKCEFSVGYSLQGKPTVGFMLGNFREGVTAVEEPLG
CPNVSSVACKYASIFQEFLQQSGLPIWNRFKNTGFWRQLTVREGRLPRKAADIAIPEAHI
SEVMLIVQVSSVGFDDDMITNELRGLAHAFTTGAAGSAPPLPLTALVIQDHQGLSNVAPA
DAPLRTLLLPNANGGSEVQATSNVAEARIHDYISNLRFSISPTAFFQVNTLAAEKLYSLA
GDWAGLGPDSLLFDICCGTGTIGLTLADRVGMVVGIEMNASAVSDAHRNAEINGIKNCRF
VCAKAEDVIGSLLKEYLDVPQKEGEQLNASEIRDKEIAMVEVNNAPMDDVLDSSKNPSHD
LGNGEGASGESENDGQEIQSQLQKSCTSKEGSSSMLHFKNVVAIVDPPRGGLHPIVIKVL
RTHSRVRRLVYISCNPETLVANAIELCTPSPEKVEKGNRNRAWRKMSSAGLARHRVKSMP
VSEPFRPVKSVAVDLFPHTSHCEMVMLLER
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtcatctccaaagaaccaactctcttcttcttctgaaaccctaaacctcccg
tccgaaacttcccttacccagaccaacccaatgaacgcccaagattcacccattccccct
gagcaacaaatccagccgtccaacaaccaagatgacaccgccaccacaactggggagaag
cgaaagcgagagaagacaacaacaacaacgacagaagcagaaacagaaacagaaacagac
ccttcactcaatccattccataaaacctcgctctgttcctacttcaggcggcacatgggg
gcctcctgtagccacggcagtgcgtgtaagtacgcgcacggcgaagaggagttgaggccc
cgcccggataacacctgggatcctacctcggagcgtgccaagaaagctatcaagctggac
accaccaataataatgatagcaaggaagaagatgaagatgaggagatcatgatgactgat
attgctgctgacggtgatggtgatgggggttgtttggatactgggcttagtaaatgcttg
gtacatttgccccgcaagtggctttctgatcatttgaggaaatttctaagtgatcaaggg
attcttttcaaatctgctaagaaaaagaaaggcatgtccgtgggtttcctaagtttcgag
gatgctgagcaattgaaaaaagcaatcgaggagctggaaggaagatctattggaaacaag
aatataaaggttgccgatgtcattccccgacaatttgagcagaaaatcaaatcagcaatg
gctgcccctcaaaacattccgcagacaatggaacctgcattggatggagaaaatgctggg
atctctagaccttcagatgctattggggatggtgatgggaataatgacaattcaacacaa
gatggttcaagctctcaggccaaatgtgcccgtgatgtcgcaacaccccttgctcatatg
ccttatgatgatcagttggagcacaagaagaactctatcatgcaaatgctcaaaaaactt
acaagaaatgcacgcaaagcttgtcctaatggagtttctcttccagaatggattctcaaa
tctagagaaataggtggtcttccatgtgaactagagggtatacttgaatcaccacttaga
aatggatatcgtaataaatgcgagttttctgttggatattctcttcaaggaaaacctact
gtgggttttatgctaggaaactttagggaaggtgtgacagctgtagaagaacctcttggc
tgccccaatgtttctagtgttgcctgcaagtatgcgtcaatctttcaggaatttttgcaa
caatctggcttgccaatttggaatagatttaagaatactggattctggcgtcaattaacg
gttcgagaaggaagattaccaaggaaagctgctgatattgcaattcccgaggcccacata
tcagaggtcatgcttattgttcaggtctcctctgtgggctttgatgatgacatgataacc
aatgaactaagggggttggctcatgcatttaccactggagctgctggaagtgctccacct
ttgcctttaacagctttggttattcaggatcaccaaggactatcaaatgttgcaccagct
gatgctccattgcgcacgctactccttccaaatgcaaatggtggttccgaggttcaagca
accagtaatgttgctgaagcaagaattcatgattatataagtaatcttcggttctctata
tcaccaacagcttttttccaggttaacacccttgctgcagagaaactatactctcttgct
ggggattgggctggtcttggtccagatagcttgctatttgatatatgctgtgggacagga
acaattggcctcactttagcagatcgtgttggcatggttgttggcattgaaatgaatgct
tctgcagtttcagatgctcatcggaatgctgaaattaatggcataaaaaactgtagattt
gtttgtgcaaaggcagaggatgtgattgggtctttattgaaggagtatctagatgtgcct
cagaaagaaggtgaacagctgaatgcatctgaaatcagggataaagaaatagcaatggtt
gaagttaacaatgctcccatggatgatgtcctagactctagcaagaacccaagccatgat
cttggaaatggtgaaggtgcttctggggaatcagaaaatgatggacaagaaatccaaagt
caacttcagaagagttgcacatcaaaagaagggagttcttcaatgttgcattttaaaaat
gttgttgccattgttgatcctccccgtggcgggctgcatcccattgtgattaaagttctg
agaactcattcacgtgtacggagacttgtttacatttcttgcaatcctgaaaccttagtg
gccaatgctattgagctctgcaccccttctcctgagaaagttgaaaaagggaatagaaac
agggcatggaggaagatgagcagcgctggtttggcacggcacagagtcaagtctatgccc
gtttcagagcctttccgacctgtaaaatccgtggctgttgatcttttcccacatacctca
cattgcgaaatggtgatgcttctggagaggtaa

DBGET integrated database retrieval system