KEGG   Populus trichocarpa (black cottonwood): 7493962Help
Entry
7493962           CDS       T01077                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop00051  Fructose and mannose metabolism
pop00052  Galactose metabolism
pop00500  Starch and sucrose metabolism
pop00520  Amino sugar and nucleotide sugar metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Module
pop_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7493962
   00051 Fructose and mannose metabolism
    7493962
   00052 Galactose metabolism
    7493962
   00500 Starch and sucrose metabolism
    7493962
   00520 Amino sugar and nucleotide sugar metabolism
    7493962
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    7493962
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pop04131]
    7493962
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     7493962
Membrane trafficking [BR:pop04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    7493962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 7493962
NCBI-ProteinID: XP_024456251
LinkDB All DBs
Position
5
AA seq 495 aa AA seqDB search
MSVAATTSPAFGTLYVSPSPRSRGTPRVTMALRSVVSVGSILTKLQQDCATPLPVIRHVA
DSMTADMRAGLAVDGGSNLKMILSYVDSLPSGNEKGLFYALDLGGTNFRALRVQLGGKEE
RVVATEFEQLSIPQGLMFGTSEELFDFIASTLAGFAEKESKKFHLPHGRQREIGFTFSFP
VKQTSIDSGILMKWTKGFAVSGTAGRDVVACLNEAMERQGLDMRVSALVNDTVGTLAGAR
YWDDDVMVAVILGTGTNACYVERTDCIPKLQGPKSSSGRTIINTEWGAFSDGIPLTVFDR
DMDAASINPGEQIFEKTISGMYLGEIARRALVTMAGEGSLFGRAVPNKLSTPFALRTPDI
CAMQQDNSDDLQAVGSILHNVAGVESSLSARKIVLEVCDALVKRGGRLAGAGIVGILQKM
EEDSKGTIFNKRTVVAMDGGLYEHYPQYRSYLQDAVTELLGSEISKNIVIEHSKDGSGIG
AALLAATNSKYDHDF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttgccgcaaccacttcaccggcctttggaacactttacgtttccccttctcct
aggagcaggggcacgcctcgagtaacgatggctctccgatctgttgtttcagtaggctcg
atcttgactaagttacagcaagactgtgcaactcctttaccggtcattcgccacgtggcg
gattccatgactgctgacatgcgagctgggcttgctgttgatggtggcagcaatctcaag
atgatactcagctatgttgatagcttgcctagcggaaatgagaagggattgttttatgca
ttggatcttggaggcacaaattttcgggcgctgagggtgcagttaggtgggaaagaagag
agagttgttgccacggaatttgagcaattatcgattcctcaagggcttatgtttggtaca
tctgaggagcttttcgattttattgcatccacactggctggatttgcagaaaaggagagc
aagaaatttcacctgccgcatggaaggcaaagggaaattgggttcacattttctttccct
gtgaagcagacatccattgactctggcatattaatgaagtggaccaagggttttgcagtc
tccggaacggcagggcgagatgtcgttgcttgtctgaatgaagctatggaaagacaagga
ttggatatgcgtgtgtctgccctggttaatgatactgtgggaactttagcgggagcaaga
tactgggatgatgatgtcatggttgctgttattttgggtactggaactaatgcatgctat
gtagaacggacggattgcattccaaaactacaggggcctaagtcttcttctggaagaaca
attattaacacagaatggggagcgttttcagatggtattcctttgactgtgtttgataga
gatatggatgcagctagtatcaatcctggtgagcagatatttgagaagacaatctctgga
atgtatctaggagaaattgcacggcgagctctagtcacaatggctggagaaggttctttg
tttggcagggccgtcccgaataaactatccacacctttcgcactccggacaccagatata
tgcgcaatgcagcaggacaattcagatgatcttcaagccgttggttcaattctacataat
gtagctggggttgaatccagcttaagtgcaaggaagattgtattagaggtttgcgatgcc
cttgtaaagagaggtggacgcttggcaggtgcaggaattgttgggattcttcaaaaaatg
gaagaggattcaaaaggtaccatcttcaataaaagaacagtggttgccatggacggtgga
ttatatgagcactaccctcagtacagaagttaccttcaagatgctgtcaccgagcttctg
ggatcagaaatttcaaaaaacatagtcatagaacattcaaaggatgggtctggtattgga
gctgctctcctagcagccacaaactccaagtatgatcatgatttttag

DBGET integrated database retrieval system