KEGG   Populus trichocarpa (black cottonwood): 7494518Help
Entry
7494518           CDS       T01077                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00250  Alanine, aspartate and glutamate metabolism
pop00410  beta-Alanine metabolism
pop00430  Taurine and hypotaurine metabolism
pop00650  Butanoate metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Module
pop_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    7494518
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    7494518
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    7494518
   00430 Taurine and hypotaurine metabolism
    7494518
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     7494518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 7494518
NCBI-ProteinID: XP_002305927
UniProt: B9H3K1
LinkDB All DBs
Position
4
AA seq 498 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRASLPRFKMPENSIPKEAAFQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPEKAVQMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKSTGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNVMENCRDNMLVLKQGLEK
TGKFNIVSKDNGVPLVAFSLKDNSLHNEFEVSDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVIDIGKVLHELETLPSRISAKIVLANEEKDAVADKDKKDVQKETREI
ITAWRKLVIQRKKMNGVC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaagacagcttcagaatctgatgtctccgttcactcaacttttgcttct
agatatgttcgagcttcacttcccaggttcaagatgccagagaactcgatcccgaaggag
gcagcctttcagatcataaacgatgagctcatgctggatggaaaccctaggctgaaccta
gcatcgtttgtgacgacatggatggagcctgaatgtgacaagcttatcatggcttctatc
aacaaaaactacgtcgacatggatgaataccctgtcaccactgagcttcagaatcgatgc
gttaacatgatagcccatctcttcaatgctccacttggagactcagagacagcggtagga
gtaggaactgttggatcttctgaggctataatgttggctggtttggcattcaagaggaag
tggcaaaacaagagaaaagctgagggaaagccttacgataagcctaacattgtcacggga
gccaatgttcaggtatgttgggagaaatttgcaaggtactttgaggtggagttgaaggag
gtgaagcttagtgatggctattatgtgatggatcctgagaaagcagtgcaaatggtggat
gagaacacaatctgtgttgcagctattcttggttccactcttaatggagaatttgaagat
gtcaagctcttgaatgatctcctggtggagaagaacaaatcaacaggttgggatactccg
atccatgtcgatgcggccagcggtggcttcattgcaccttttatatacccggagctcgag
tgggatttccggttgccattggtgaagagtatcaatgtcagtgggcacaaatatggacta
gtctatgctggtattggatgggtcatttggaggaacaaggaggacttgcctgaagaactt
atcttccatatcaattatcttggagctgatcaaccaaccttcacccttaacttctccaaa
ggatctagtcaagttattgctcaatattaccaactcattcggttgggttacgagggatac
agaaatgtcatggaaaattgtagagacaacatgctggtactcaaacaaggactagagaag
acaggcaagttcaacattgtttcgaaagacaatggggtgccactggtggccttttctttg
aaggacaatagcttgcacaacgaatttgaggtgtccgacatgttaaggcgttttggttgg
attgtgcctgcctacaccatgcctcctgatgctcaacatgttactgtgttgcgcgtcgta
attcgagaagatttttctcggacactcgctgagcgtcttgtcattgacattggcaaggtt
ctacatgagcttgagacattgccatccaggatcagtgccaagattgtgttggctaatgaa
gagaaggatgccgtggccgataaagacaagaaggacgtccagaaagaaacaagagagatt
attacagcttggaggaagcttgtcattcaaaggaagaagatgaatggtgtttgctag

DBGET integrated database retrieval system