KEGG   Populus trichocarpa (black cottonwood): 7495149Help
Entry
7495149           CDS       T01077                                 

Definition
(RefSeq) uncharacterized protein LOC7495149 isoform X2
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: PUF
Motif
Other DBs
NCBI-GeneID: 7495149
NCBI-ProteinID: XP_002301047
LinkDB All DBs
Position
2
AA seq 755 aa AA seqDB search
MMMMMMYKQQSEREKKVMEKMRKREEELLNGGGLNGSYLRLLHKKSLLSGSPLSDTSVSL
QSSPEFSPSSSFSNGFFSSEDASGSPFATAPPLSPPLFEEATCHQSPSYLYFNGLSLDDS
KSPHNINDLSQDFVRMNIREEQNGGVKMKGFEMDPHGDGFGFGDVGVDGSLGVGIVPYNV
KNHGSYGGLNNGDFSNDGCDSESFQSSTRGVSLSCNDVMGCRFNGFEKGGFDSVESFPAH
NHQSDDFCPGSRWFKNQSDYFLEQSKKQGKWRYEGPHQSQNPFSTRPFVNDALVGPQQYK
MDSNGGRVAMDSLSYSLLNGHDRLGESLLLKGRTVPSTRNGVPQSLMSMKGAGDMESLCR
EDSFILQGRGLNHASHRGHDALRDHNKNHFNEIAVRNMQGESIKPDDCSLHEGIRENGRR
LGSHSPLPMAPSFTSLNEFRGYVYLMAQDQNGCLFLQKIFEEGTSQDVELIFDEIIGHIV
ELMLKPFGNYVVQKLLDVCDEKHRLLIVRMITNEPGMLVRICLNTYGTRVVQRLIETLKT
RQQISSVILALKPGVLDLVKDQNGNHVIQRCLNLLSNEDNKFIFDAATKFCVEIATHRHG
CCVMQRCIAHATGKHWDKLMTEISRNGLLLAQDPFGNYVVQYIMDLKNSCSIAILLSQFK
GNYVHLSMQKFGSHVVERCLGHFEESRSQIVLELLSVPRFEQLLQDPFANYVIQCALAVT
KGALHSLLVEAVRPHSTLRTSPYCKRIFSRNLLKK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgatgatgtataaacaacaatctgagagggaaaagaaggttatggagaag
atgaggaagagagaggaagagctgttgaatggaggaggactgaatgggtcatatttgagg
cttcttcataagaagtcacttttgagtggttctcctttgagtgatactagtgtatcattg
caatcatcacctgagttttctccttcaagctctttctcaaatgggtttttctcttctgag
gatgcttcaggctcaccatttgcaacagcacctcctctttctcctcctttatttgaagag
gctacgtgtcatcaatcacccagttacctttactttaatggactgagtttggatgattct
aaatcacctcataacatcaatgatttgtctcaagattttgttagaatgaatattagagag
gaacaaaatggcggcgttaaaatgaagggatttgagatggacccccatggtgatggtttt
ggttttggtgatgtaggtgttgatggttctctgggtgtgggtattgtaccatataatgtt
aaaaatcatggctcttatggtggtttaaacaatggggattttagcaatgatggttgtgat
tcggaaagctttcaatcatctactcgtggagtttctttgagttgtaatgatgttatggga
tgtagatttaatggatttgaaaagggtggttttgattcagtggagtcttttcctgcccat
aatcaccagtccgatgatttttgtcctggctctaggtggtttaaaaaccagagcgattat
tttttggagcagagcaaaaaacagggaaaatggagatatgaggggcctcatcaatcgcag
aacccatttagcactagacctttcgttaacgacgctcttgttggccctcagcaatataaa
atggattctaatggaggcagggttgccatggattcattgagttactctttgttgaatggt
catgatcgattgggtgaaagtctgctgttaaaaggaaggactgtaccaagcactcgcaac
ggtgttcctcagtctctcatgtctatgaaaggtgcaggggatatggaaagtctttgccgc
gaggatagtttcattttacaaggaagaggtctcaatcatgccagccatagaggacatgat
gctttgagagatcacaataagaatcacttcaatgagattgctgtgcggaacatgcagggg
gaaagcattaaaccagatgattgttctcttcatgaaggaatacgtgaaaatggtcggaga
ctaggtagtcatagcccattgccaatggctccaagttttacttccttgaatgagttccgg
ggttatgtatacttaatggcacaagatcagaatggttgccttttcttacaaaagattttt
gaagagggaacaagccaagatgttgaactaatatttgatgaaattattggccatattgtt
gaacttatgttgaagccatttggcaattatgtcgtccagaagctattggatgtgtgcgat
gaaaaacatagattgctgatagtgcgcatgatcaccaatgagcccggaatgcttgttaga
atttgcttaaacacatacggcacacgagtagtgcagaggttgatcgagactctcaaaacc
aggcagcagatttcttcagtaatattggccctgaaacctggtgtgcttgatcttgtcaag
gatcagaatggaaatcatgttattcagcgttgtttgaacctcctgagcaatgaagataac
aagttcatttttgatgctgcgacaaagttttgtgttgagatcgcaactcatcgtcatgga
tgctgtgtaatgcaacgatgtattgcacatgccactggaaaacattgggataagttaatg
actgaaatttctagaaacggacttcttcttgcacaagatcctttcggaaattatgttgtt
caatacatcatggatctgaagaactcatgtagcattgccatcttgctttctcaattcaaa
gggaactatgtgcacctctccatgcaaaaatttggcagccatgtggttgagaggtgcctt
gggcattttgaagagagccggtcacaaattgttcttgaactgctctcagtgcctcgcttt
gaacagctgctgcaggatccatttgccaactacgtcattcaatgtgctttagcagttacc
aagggtgctcttcattctttactggtcgaagcagtccgaccacactcaacgttacgcacc
agcccgtattgtaagagaatcttctcacgaaacctgttgaagaaatga

DBGET integrated database retrieval system