KEGG   Pseudomonas oryzihabitans: APT59_07760Help
Entry
APT59_07760       CDS       T04267                                 

Definition
(GenBank) p-hydroxycinnamoyl CoA hydratase/lyase
  KO
K18383  feruloyl-CoA hydratase/lyase [EC:4.1.2.61]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00998  Biosynthesis of various secondary metabolites - part 2
por01100  Metabolic pathways
por01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    APT59_07760
Enzymes [BR:por01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.61  feruloyl-CoA hydratase/lyase
     APT59_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ALZ84112
UniProt: A0A0U4VLS1
LinkDB All DBs
Position
1717102..1717932
Genome map
AA seq 276 aa AA seqDB search
MGSYDGRWQTVKVDIEDGIAWVTLNRPEKRNAMSPTLNREMVEVLETLEQDANAGVLVLT
GAGDAWTAGMDLKEYFRETDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGG
GFSPLVACDLAITADEATFGLSEINWGIPPGNLVSKALADTVGHRTALYYVMTGKTFSGP
EAAAMGLVNQSVPRDQLREVTTALARELLDKNPVVLRAAKVGFKRCRELTWEQNEDYLYA
KLDQSRLQDPEGGREQGMKQFLDDKSIKPGLQTYKR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttacgacggacgctggcagacggtcaaagtggacatcgaggacggtatcgcc
tgggtgacgctcaatcgtcccgagaaacgcaacgccatgagtcccaccctcaaccgcgag
atggtcgaggtgctggagaccctggagcaggacgccaacgccggcgtgctggtgctgacc
ggtgccggcgatgcctggaccgcgggcatggatctcaaggaatacttccgcgagaccgat
gccggccctgaaatcctgcaggagaagattcgccgcgaggcctcccagtggcagtggaag
ctcctgcgcatgtacgccaagccgaccatcgccatggtcaacggctggtgctttggcggc
ggcttcagcccgctggtggcctgcgatctggccatcaccgccgacgaggccaccttcggc
ctgtccgagatcaactggggcattcctccgggcaacctggtgagcaaggccctggccgac
accgtgggtcaccgcaccgcgctctactatgtgatgaccggcaagaccttcagcggtccc
gaagccgccgccatggggctagtcaaccagagcgtgccacgtgaccagttgcgtgaggtg
accaccgccctggcacgtgagctgctggacaagaatccggtggtgctgcgtgccgccaag
gtcggcttcaagcgctgccgcgaactgacctgggagcagaacgaggactacctctatgcc
aagctcgaccagtcgcgtctgcaggatccggaaggcggtcgcgagcagggcatgaagcag
ttcctcgacgacaagagcatcaagcccggtctgcagacctacaaacgctag

DBGET integrated database retrieval system