KEGG   Pseudomonas oryzihabitans: APT59_09050Help
Entry
APT59_09050       CDS       T04267                                 

Definition
(GenBank) crotonase
Organism
por  Pseudomonas oryzihabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ALZ84345
UniProt: A0A0U4XSR6
LinkDB All DBs
Position
complement(1979089..1980141)
Genome map
AA seq 350 aa AA seqDB search
MSDAKVLLERRGGVGYLTLDRPAGLNALDLEMVRSLHGALRDWEGDPGVRVVVLRGNGPK
AFCAGGDVRALYDSYQRGDDLHQIFFTEEYALDLALHRYPKPVLALAHGLVLGGGMGLVQ
AARLRIVSERTRMAMPETAIGYFPDVGASHFLPRLPDHLGLYLGLTGEQIGPADALAAGL
ADVFVPEASNEALAQRLEEATAQGPTDLAALLQEFAGAPAETARLTDLRPAIAEHFAAAT
VEELRGSLQAESRPAYRDWAQETLATLDRRSPLAVATALELLRQGSGLSLEQCFALELHL
DRRWFEKGEIVEGVRAMLVDKDRTPHWNPARWQDLDPRRVAAFFTDFRHS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgccaaggtactgttggaaagacgcggcggggtcggctacctgaccctcgat
cgcccggccgggctcaatgccctggacctggagatggtgcgcagcctgcacggcgccctg
cgcgactgggaaggcgaccccggggtgcgggtcgtggtgctgcgcggcaacgggcccaag
gccttctgcgccggcggcgatgtccgcgcgctgtacgacagctaccagcgtggcgacgac
ctgcaccagattttcttcaccgaggaatacgccctggacctggccctgcaccgctatccc
aagccggtgctggcactggcccatggcctggtgctgggcggcggcatgggcctggtgcag
gccgcgcgactacgcatcgtcagcgaacgtacgcggatggccatgccggagaccgccatc
ggctattttcccgatgttggcgccagccacttcctgccacgcctgccggatcacctcggc
ctttatctgggcctgaccggcgagcagatcggcccggctgatgccctggccgcggggctc
gccgatgtcttcgttccggaagccagtaacgaggccctggcgcagcgcctggaagaggcc
acggcccaaggaccgacggacctggccgccctgctccaggaattcgccggggcgccggcc
gaaaccgcccgcctgaccgacctgcgtccggccatcgccgagcacttcgccgcggcgacc
gtagaggagctgcgcggcagcctgcaggcggaaagccgccccgcgtatcgcgactgggcg
caggaaaccctcgccaccctggataggcgctcgccgctggcggtcgccacggcgctggag
ttgctgcgccagggcagcgggctgtcgctggagcaatgcttcgccctggagctgcacctg
gatcgccgctggttcgaaaaaggcgagatcgtcgaaggggtgcgcgccatgctggtagac
aaggaccgcacgccccactggaatccggcccgctggcaggatctggatccgcgtcgcgtc
gcggcctttttcaccgatttccgccattcctga

DBGET integrated database retrieval system