KEGG   Pseudomonas oryzihabitans: APT59_10215Help
Entry
APT59_10215       CDS       T04267                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
por  Pseudomonas oryzihabitans
Brite
KEGG Orthology (KO) [BR:por00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APT59_10215
Enzymes [BR:por01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     APT59_10215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like K_oxygenase Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALZ84551
UniProt: A0A0U4VNC1
LinkDB All DBs
Position
complement(2201160..2202719)
Genome map
AA seq 519 aa AA seqDB search
MLDANLKAQLKTYLERVTRPIEIVASLDDGAKSREMHSLLQDIASLSDQVSLSTDGSDER
RPSFALLTPGQNINLRFAGLPMGHEFTSLVLALLQVGGHPSKASQDVIEQVKALDGDYQF
ETYFSLSCQNCPDVVQALNLMAVLNPRVKHVAVDGALFQEEVERRQIMAVPSVYLNGEPF
GQGRMGLEEIVAKLDTGAAARSADKLNAKDAFDVLVIGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVLDTLAIENFISIKETEGPKLAMALEEHVKQYEVDIMNLQRAEQLIPAHEVGG
LHEVRFADGGSLKAKTLILATGARWREMNVPGEREYRNRGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAQVTLIEYDGQLRADAVLQRKLFSLPNVTVITSALTSEVKGDG
QKVDGLVYKDRNSSEFHHIELEGVFVQIGLVPNTDWLKGTVELSPRGEIEVDARCQTSLP
GVFAAGDVTTVPYKQIVIALGEGAKASLAAFDHMIRTSA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctgaaagcccagctcaagacctacctcgaacgcgtcacgcgcccc
atcgagatcgtcgcgtccctcgacgatggcgcgaagtcccgtgaaatgcacagcttgctg
caggacatcgccagcctgtccgatcaggtgagcctcagcaccgacggcagcgatgagcgt
cgtccctccttcgccctgctgacccccggccagaacatcaacctgcgcttcgccggtctg
cccatgggccatgaattcacgtccctggtactggcactgctgcaggtcggcggccatcca
tccaaggccagccaggacgtcatcgagcaggtcaaggccctcgacggcgactaccagttc
gaaacctatttctccctgtcctgccagaactgtccggacgtggtccaggcgctgaacctg
atggccgtgctcaatccccgggtcaagcacgtcgccgtggacggcgccctgttccaggaa
gaagtcgagcgccgccagatcatggccgtgcctagcgtctacctcaacggcgaacccttc
ggccaaggccgcatgggcctggaagaaatcgtcgccaagctcgacaccggcgccgctgcc
cgctccgccgacaagctcaacgccaaggacgccttcgacgtcctggtcatcggcggtggc
cctgccggtgccgcagcagccgtctacgctgcacgcaagggcatccgtaccggcgtcgcc
gccgagcgcttcggcggtcaggtgctggataccctggccattgagaacttcatctccatc
aaggagaccgaaggtcccaagctcgccatggcgctggaagaacacgtcaagcagtacgaa
gtcgacatcatgaatctgcagcgcgccgagcagctgattccggctcatgaagtcggcggc
ctgcacgaagtccgcttcgccgatggcggctcgctcaaggccaagacgctgatccttgcc
accggtgcccgctggcgtgaaatgaacgtcccaggcgaacgggaataccgcaaccgcggc
gtggcctactgcccccactgtgatggccccctgttcaagggcaagcgcgttgccgtgatc
ggcggtggtaactcgggtgtcgaggccgccatcgacctcgccggcatcgtcgcccaggtg
accctgatcgaatacgacggccagctgcgtgccgacgccgtactgcagcgcaagttgttc
agcctgcccaacgtgaccgtcatcaccagcgccctcactagcgaagtgaaaggtgatggt
caaaaagtcgacggtttggtctacaaggatcgcaattccagcgagttccatcacatcgag
ctcgaaggcgtctttgtgcagatcggtctggtccccaacaccgattggctcaagggcacc
gtagagttgtcgccgcgtggcgagatcgaagtggacgcccgctgccagacctccctgcct
ggcgtcttcgccgcaggcgacgtcaccaccgtaccttacaagcagattgtcatcgccctg
ggcgaaggcgccaaggcgtccctggctgccttcgatcacatgattcgtaccagcgcctaa

DBGET integrated database retrieval system