KEGG   Pseudomonas oryzihabitans: APT59_11985Help
Entry
APT59_11985       CDS       T04267                                 

Definition
(GenBank) gamma-carboxygeranoyl-CoA hydratase
  KO
K13766  methylglutaconyl-CoA hydratase [EC:4.2.1.18]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00280  Valine, leucine and isoleucine degradation
por01100  Metabolic pathways
Module
por_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT59_11985
Enzymes [BR:por01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.18  methylglutaconyl-CoA hydratase
     APT59_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SPOUT_MTase
Motif
Other DBs
NCBI-ProteinID: ALZ84873
UniProt: A0A0U4XTZ8
LinkDB All DBs
Position
2584642..2585442
Genome map
AA seq 266 aa AA seqDB search
MTDFQTLDLTRDPRGFATLWLDRPDRHNALDARMIAELGTALTEIAADAELRFLLVRGRG
RHFCAGADLAWMQASATLDAAANQADTERLAEVMYRLQALSMPTLAVVQGAAFGGAVGLV
SCCDLAVAASDATFCLSEVRIGLVPAVIGPFVIRALGERVARRYMLGAERFSGARAAELG
LVAETAPAADLEPLVEAWIARLLDNGPQALRACKRLLDGVGDGVPSPTVRQFTEGLIAAV
RVTPEAQEGLAAFLEKRRPAWQETTP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttccaaaccctggatctgacccgcgacccgcgcggcttcgccaccctctgg
ctcgaccgtccggaccgccacaacgccctggatgcacggatgatcgcggagttgggcaca
gcgctcaccgagatcgccgccgatgccgagctgcgctttctgctcgtacgtgggcgcggc
cggcacttctgcgcgggtgccgacctggcttggatgcaggcgtccgccaccctggacgcg
gccgccaaccaggccgacaccgagcgcctggccgaggtgatgtatcgcctgcaggccttg
tcgatgcccaccctcgccgtggtgcagggcgcagcctttggcggcgccgtgggtctggtc
agttgctgcgacctcgccgtggctgccagtgacgccaccttctgcctgtcggaggtgcgc
atcggcctggtgcccgccgtcatcggccccttcgtcatccgcgccctgggcgaacgggtg
gcacggcgctacatgctgggtgccgaacgcttctccggtgcgcgcgccgccgagctgggc
ctggtcgccgagaccgcgcccgccgccgacctggagcccctcgtggaagcctggatcgcc
cgcctgctggacaacggtcctcaggccttgcgggcctgcaaacggctcctggacggcgtc
ggcgatggtgtgccgagccccacggtgcgccagttcaccgagggcctgatcgccgcggtc
cgcgtcacccctgaagcccaggaaggcctagccgctttcctggaaaagcgccgccccgcc
tggcaggagaccacgccatga

DBGET integrated database retrieval system