KEGG   Pseudomonas oryzihabitans: APT59_12290Help
Entry
APT59_12290       CDS       T04267                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA epimerase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00071  Fatty acid degradation
por00362  Benzoate degradation
por00650  Butanoate metabolism
por01100  Metabolic pathways
por01120  Microbial metabolism in diverse environments
por01200  Carbon metabolism
por01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    APT59_12290
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT59_12290
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT59_12290
Enzymes [BR:por01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APT59_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 DAO FAD_binding_3 ApbA Pyr_redox_2 F420_oxidored GIDA Methyltransf_12 NAD_binding_8 UDPG_MGDP_dh_N NAD_Gly3P_dh_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ALZ84929
UniProt: A0A0U4P1X7
LinkDB All DBs
Position
complement(2654836..2656917)
Genome map
AA seq 693 aa AA seqDB search
MTTVTLQRIDALGVITLDHPPVNALSREVRAGLLARLQEGLADDGIQTLVITCAGRTFVA
GADIREFDLPLQEPHLPEVLAALEASPKPVLAALHGTVLGGGLELALACHYRVAATGTTF
ALPEVSLGLIPGAGGTQRLPRLVGAPLALDMIVGGTRLDASAALGAGLIDGLGEGAPLAL
AQGFLREHPPLSPRPTAAQTVSPFDPDAFEVQAHTLLRKLPGQEAPVLALDALCGAWQLP
LSAALQRERELFVARRESAQARALRHVFFAERALAGRNRALAKAAPPVALRQVAVIGAGL
MGSGIALCLANAGLATVLIDTQPQALERGRATIDSYFSGALAKGRLTADQANARAALIRC
EATLDAVADADLIIEAVFEDLAVKQEVFRQLDRLAKPGAILATNTSYLDIDAIAGVTGRP
EAVIGMHFFSPAQVMTLLEVVRTRAVAPAVLASTLQLGERLGKTTVAVGNCHGFVGNRLL
AVREREATLLVEEGAAPEQVDQVLREFGFPMGPFELRDLAGIDIAWRNRQGRGESLSPAE
RACDLIEQLHALGRLGQKSGAGYYRYEPGQRRGQADPLVAELLAAHRERRGVTPRSYSDT
EILERCLFVMINEAAWLLEEGIVEQAVDIDLVWLHGYGFPRYRGGLLYHADECGLERIVT
TLEGWSAALAERGTRISPRLRQLAAEGRTFLDL
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtaaccctgcaacggatcgacgccctgggcgtcatcaccctggaccatcca
ccggtcaatgccctgtcccgcgaggtgcgtgcggggctcctggcacggctgcaggagggc
ttggccgatgacgggatccagaccctggtgatcacctgcgccggacggaccttcgtcgcc
ggcgccgacatccgcgaattcgacctgccgctgcaggagccccatctgccggaggtgctg
gcggccctcgaagcctcgcccaagccggtgctcgccgcgctgcatggcacggtattgggc
ggtgggctggaactggcattggcctgtcattaccgggtcgcggcgaccggcaccaccttc
gccttgccggaagtcagcctgggcttgatcccgggcgcgggcggcacccagcgcctgccg
cgcctggttggcgcacccctggcgctggacatgatcgtgggcggcacgcgcctggatgcc
agcgcggcgcttggcgcggggctgatcgatggtctgggcgagggtgcgccgctggccctg
gcccagggctttctgcgtgaacatccccccttgtcgccacggccgacggcggcgcagacg
gtatctccgttcgaccccgacgccttcgaggtccaggcgcataccttgctgcgcaagctg
ccgggccaggaggcacccgtgctggcgctggatgccttgtgcggtgcctggcagctgccg
ctgtccgccgccctgcagcgcgagcgtgagctgttcgttgcccggcgcgagtccgcccag
gcccgagccctgcgccatgtgttcttcgccgagcgcgccctggcgggtcgtaaccgcgcc
ctggccaaggcggcgcctcccgtagcgttgcggcaggtggcggtgatcggcgcggggctg
atgggcagcggtatcgccctttgcctggccaacgccggcttggccaccgtcctgatcgat
acccagccccaggccttggagcgaggccgcgccactatcgacagctatttctccggggcc
ctggccaagggccgcctgacggccgatcaggccaacgcgcgcgccgccctgatccgctgt
gaagcgaccctggacgcggtagccgacgccgatctgatcatcgaggcggtgttcgaggat
ctggcggtcaagcaggaggtctttcgccagctcgatcgcttggccaagcccggcgccatc
ctggccaccaacacctcctatctcgacatcgatgccatcgccggagtgaccggccgaccg
gaggcggtgatcggcatgcacttcttcagcccggcccaggtgatgacgctcctggaggtg
gttcggacccgcgcggtcgcgcccgccgtcctggccagtaccctgcaactgggcgagcgt
ctgggcaagaccacggtggcggtgggcaactgccatggcttcgtcggcaatcgcctgctc
gcggtgcgtgagcgcgaggcgaccctgctggtggaagagggcgccgcccccgaacaggtc
gaccaggtgctgcgtgaattcggctttcccatgggtcccttcgagctgcgtgacctggcc
gggatcgacatcgcctggcgcaatcgccaggggcggggtgaatccctcagccctgccgag
cgggcctgcgacctgatcgagcagctgcacgccctcggtcgtcttggccagaagtccggc
gccggctactaccgctatgaaccgggtcagcgccggggccaggcggatcccctggtcgca
gagctgctcgccgcccaccgtgagcgccggggcgtcaccccacgcagctacagtgatacg
gagatcctcgaacgctgcctgttcgtgatgatcaacgaggcggcctggctgctggaggag
ggcatcgtcgagcaagcagtggacatcgatctggtctggctgcacggctacggctttccg
cgctatcgcggcgggctgctgtaccacgccgacgagtgtgggctggagcggatcgtcacc
accctggaaggctggtccgccgccctggccgagcgcgggacgcgaatctcgccgcggctc
aggcagctggcggccgaaggccggacatttctggacctatga

DBGET integrated database retrieval system