KEGG   Pseudomonas oryzihabitans: APT59_12600Help
Entry
APT59_12600       CDS       T04267                                 

Definition
(GenBank) 2,3-dehydroadipyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00071  Fatty acid degradation
por00280  Valine, leucine and isoleucine degradation
por00281  Geraniol degradation
por00310  Lysine degradation
por00360  Phenylalanine metabolism
por00362  Benzoate degradation
por00380  Tryptophan metabolism
por00410  beta-Alanine metabolism
por00627  Aminobenzoate degradation
por00640  Propanoate metabolism
por00650  Butanoate metabolism
por00903  Limonene and pinene degradation
por00930  Caprolactam degradation
por01100  Metabolic pathways
por01110  Biosynthesis of secondary metabolites
por01120  Microbial metabolism in diverse environments
por01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    APT59_12600
   00650 Butanoate metabolism
    APT59_12600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT59_12600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT59_12600
   00310 Lysine degradation
    APT59_12600
   00360 Phenylalanine metabolism
    APT59_12600
   00380 Tryptophan metabolism
    APT59_12600
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APT59_12600
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APT59_12600
   00281 Geraniol degradation
    APT59_12600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT59_12600
   00627 Aminobenzoate degradation
    APT59_12600
   00930 Caprolactam degradation
    APT59_12600
Enzymes [BR:por01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APT59_12600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Adenyl_transf
Motif
Other DBs
NCBI-ProteinID: ALZ84987
UniProt: A0A0U4VP97
LinkDB All DBs
Position
2729915..2730688
Genome map
AA seq 257 aa AA seqDB search
MPRTLNVLPPEKGVCLITLQRPEALNALSTELLGELAQALETAEREPEVRVVVLTGSRKA
FAAGADLKEMAERDLIGTLEDPRVRHWQRIAAFSKPLIAAVNGFALGGGCELAMHADILI
AGRDARFGQPEINLGIIPGAGGTQRLLRAVGKSQAMQMVLTGEAIDACQAQRVGLVSEIT
QPELTVERALEIGRLIAAKAPLAVRLAKEVLLKAQDVDLASGLKIERQAFIMLAGTADRT
EGLRAFQEKRPPRFVGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcaccctgaatgtgctgccgccggagaaaggtgtctgcctgatcaccctccag
cgccccgaggcgctgaatgccctctccaccgaactgctgggcgagttggcacaagccctg
gaaacagccgaacgggagcctgaggtccgcgtcgtggtcctcaccggcagccgcaaggcc
ttcgccgcgggcgccgatctcaaggagatggccgaacgggatctgatcggtaccctcgaa
gacccccgggtccgccactggcaacgcatcgccgccttttccaaacccctgatcgccgcg
gtcaacggcttcgccctgggcggtggctgcgagttggccatgcatgccgacatcctcatc
gccggccgcgacgcccgcttcggccaaccggaaatcaatctcggcatcatccccggcgcg
ggtggtacccagcgcctgctgcgggcggtcggcaagtcccaggccatgcagatggtgctc
accggcgaggccatcgatgcctgccaggcccagcgcgtcggcctggtcagcgagatcacc
caacccgaactcaccgtcgagcgcgccctcgaaatcggccgactcatcgcggccaaggcg
ccactggcggtgcgcctcgccaaggaggtgctgctcaaggcgcaagacgtggatctcgcc
agcgggctgaagatcgagcgccaggccttcatcatgctggcgggcaccgcggaccgcacc
gaaggccttcgcgccttccaggaaaaacgcccgccgcgcttcgtcggccgctaa

DBGET integrated database retrieval system