KEGG   Pseudomonas oryzihabitans: APT59_12605Help
Entry
APT59_12605       CDS       T04267                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K15866  2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase [EC:5.3.3.18]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00360  Phenylalanine metabolism
por01100  Metabolic pathways
por01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    APT59_12605
Enzymes [BR:por01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.18  2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
     APT59_12605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ALZ84988
UniProt: A0A0U4WKN0
LinkDB All DBs
Position
2730721..2731512
Genome map
AA seq 263 aa AA seqDB search
MTFEHLLFSVEDGVALLSLNRPEQLNSFTPPMHLELREALKQVRQTPEVRVLLLTGEGRG
FCAGQDLSDRNVAPEAAMPDLGASIETYYNPLIRALRDLPMPVICAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLIPDSGGTWMLPRLIGMARAKALALLGERLTAEQAADWG
LIYRVVDDAELRSEALKLARHLATQPTAGLALIKRSLNASFDNSFDEQLDLERDLQRLAG
RSDDYREGVSAFMAKRSPTFRGR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgaacacctgctgttctccgtcgaagacggcgtcgccctgctcagcctgaat
cggccggagcagctcaacagcttcaccccgccgatgcacctggagctgcgcgaggccctc
aagcaggtgcgccagacgcccgaggtgcgggtgctgctgctgaccggtgaagggcgcggc
ttctgcgccggccaggatctctccgatcgcaatgtggcacccgaggcggcgatgccagat
ctcggcgcctccatcgagacctactacaaccccctgatccgcgccctgcgcgacttgccc
atgccggtcatctgcgccgtgaacggcgtggccgccggcgccggggccaatatccccctg
gcctgcgacctggtcctggccgcacgctcggcgagtttcatccaggccttctgcaagatc
ggcctgatccccgactcgggcggcacctggatgctgccacgcctcatcggcatggcccgc
gccaaggcgctcgccctgctgggtgaacgtctcaccgccgaacaggccgccgactggggg
ctgatctaccgggtggtggacgacgccgaactgcgcagcgaagccctcaagcttgcccgc
catctcgcgacccagcccacggccggactggcgctgatcaagcgcagcctgaacgccagt
ttcgacaatagtttcgacgagcaactggacctggagcgcgacctgcaacgcctggccggg
cgcagcgacgactatcgtgagggtgtcagcgccttcatggccaagcgctcccccaccttc
aggggccgctga

DBGET integrated database retrieval system