KEGG   Pseudomonas oryzihabitans: APT59_14695Help
Entry
APT59_14695       CDS       T04267                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
por  Pseudomonas oryzihabitans
Brite
Enzymes [BR:por01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     APT59_14695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALZ85382
UniProt: A0A0U4W6H7
LinkDB All DBs
Position
3231633..3232160
Genome map
AA seq 175 aa AA seqDB search
MKIWTATLLATCLAGTAQAAESLTIPVNKVTTDGVGESVGSVQVTRSKYGLVFTPDLKGL
EPGIHGFHVHTKPNCGPAEVNGTLTAGGAAGGHLDPRNTGKHSAPWSDDGHLGELPALYV
TADGQATQPVLAPRIKRLEEIKGHALMVHAGGDNYSDQPKPLGGGGARVACGVIK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctggaccgcgacgctgttggccacctgcctggccggcactgcccaggcggct
gaatccctgacgattcccgtgaacaaggtcacgaccgacggtgtgggtgaaagcgtcggc
agcgtgcaggtgacccgctcgaaatatggcctggtcttcacccccgacctcaagggcctg
gagccggggatccatggtttccacgtccataccaagcccaactgcggcccggccgaggtg
aatggcaccttgaccgctggcggcgccgcgggtggtcatcttgatccgcgcaacaccggc
aagcacagcgcgccctggtcggacgatggtcacctgggcgaactgccggcgctctatgtg
accgccgacggccaggccacccagccggtgctggcgccacgcatcaagcgtctcgaagag
atcaagggccatgccctgatggtacatgccggaggcgacaactactccgatcagcccaag
cccctgggcggtggcggcgcccgcgtcgcctgcggcgtcatcaagtag

DBGET integrated database retrieval system