KEGG   Pseudomonas oryzihabitans: APT59_16310Help
Entry
APT59_16310       CDS       T04267                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APT59_16310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:por02000]
    APT59_16310
Enzymes [BR:por01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     APT59_16310
Transporters [BR:por02000]
 Other Transporters
  Pores ion channels [TC:1]
   APT59_16310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_C GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALZ85687
UniProt: A0A0U4VRJ9
LinkDB All DBs
Position
3578714..3579382
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNNSRSQRVLWLLEELGVDYRVQRYERAAGGLFAPPELRKVHPLGKSPIIVDGD
LTLAESGAIVDYLARRYGPQLLPAQDSPEFVRYTYWLHYAEGSAMTPLLLKLVFDRIATS
PMPFFARPIAKGIAAKATASFIQPQLDLHLDYLESQLGASGWFVGDRFTAADIQLSFPLE
AAASRAGLDNGKRPKLVDFLKRIHARPAYQRALEQGGSYVYA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtccaccacctgaacaactcccgctcccagcgggtgctctggctgctcgaa
gagcttggcgtcgattatcgggtacagcgttacgaacgcgccgccggcgggctgttcgcg
ccaccggaattgcgcaaggtacatcccctgggcaagtcgccgataatcgtcgacggcgac
ctgaccctggctgaatccggcgccatcgtcgactacctggcacggcgctatggaccgcaa
ctgctgccggcccaggacagccccgagttcgtgcgctacacctactggctgcactacgcc
gagggctcggccatgacaccgctgctgctcaagctggtgttcgaccgtatcgccacctcg
cccatgcccttcttcgccaggcccatcgccaagggcatcgctgccaaggccaccgcgagc
ttcatccagccgcaactggacctgcacctggactacctggaaagccaactgggcgccagc
ggctggttcgtcggcgaccgcttcaccgcggccgacatccagctcagcttccccctggag
gccgccgccagccgcgccggcctggacaacggcaagcgccccaagctggtggacttcctc
aaacgcatccacgcccgcccggcttatcaacgggcgctggagcagggtgggtcctacgtc
tacgcctga

DBGET integrated database retrieval system