KEGG   Pseudomonas oryzihabitans: APT59_18535Help
Entry
APT59_18535       CDS       T04267                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
por  Pseudomonas oryzihabitans
Brite
KEGG Orthology (KO) [BR:por00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:por03400]
    APT59_18535
Enzymes [BR:por01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     APT59_18535
DNA repair and recombination proteins [BR:por03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    APT59_18535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2
Motif
Other DBs
NCBI-ProteinID: ALZ86100
UniProt: A0A0U4X3V6
LinkDB All DBs
Position
complement(4070848..4073181)
Genome map
AA seq 777 aa AA seqDB search
MVAAQGFLLTRLWRETSTGMELVFWFATDSGPRQLRVPAQQAVAFAPAARRADIERLLPA
GVEIRELALQDFQRRPVLGLYAPRYRTLRELEQRLPAAGIDLYEADITPADRFLMERFIT
APVTLPTADGGPLRPDPDYRPTLRTLSLDIETSERGELYSIGLHGCGQRQVYMLGPPTGE
DAAVDFDLEYVDDRATLLQRLNAWMARHDPDVIIGWSVLQFDIRVLHEHARKLGVPLHLG
RGALEDDRYEPGGQGRQFQALLAGRPIIDGVEALKSATWVFPSYSLENVSRSLLGEGKAI
DNPHDRMASINRMFAGEKSALARYNLVDCELVTRIFAKTELLRFLLERASVTGLPLERHG
ASIAAFYHLYLPLMHRQGFVAPSLGAQPPEASPGGFVMDSRPGLYDSVLVLDYKSLYPSL
IRTFLIDPVGLVEGLALSEDETVPGFRGARFHRTRHCLPEMVARVWEGRDAAKRAGNAPL
AQALKIIMNSFYGVLGTPHCRFFDHRLASSITLRGHAVMHQTRELIEARGHRVIYGDTDS
TFVWLGAAHEEAEAERIGRELVAAVNAHWRERLQAELGLESHLELQYETHFSRFLMPTIR
GAEEGSKKRYAGLRPGADGQPELVFKGLETVRSDWSPLAQRFQRELYLRIFTGEPHEDYV
RDFVARTRAGDFDDLLVYRKRLRRPLEEYQSNLSPQVRAARLLEAENARLGRRRRFRRGG
WISYLITTAGAEPVELPHAPPDYDHYVQRQLAPVADAILPFVGDRFDRLLDRQMGLF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgccgcccagggtttcttgctgacacgcctctggcgcgagacgtccaccgggatg
gagctggtgttctggttcgccactgacagcggtccgcgccagctgcgggtgccggcgcaa
caggccgtggcctttgcgccagccgcgcgacgggcggacatcgagcgcctgctgccggcc
ggggtggagatccgcgagctggcgctgcaggacttccagcggcgccccgtcctggggctc
tatgcgccgcgctatcgcaccctgcgcgaactggagcagcgcctccccgccgccggcatc
gacctctacgaagccgacatcaccccggcggatcgcttcctcatggagcgcttcatcacc
gcgccggtgacactgcccacggcagacggcgggccactgcggcccgatcccgactatcgc
cccacgctgcgcaccctgtcgctggacatcgagaccagcgagcgcggcgagctctacagc
atcggcctgcacggctgcggccagcgccaggtgtacatgctcggcccgcccactggcgag
gacgcggccgtggacttcgacctggaatacgtcgacgaccgcgccaccctgctccaacgt
ctcaacgcctggatggcgcgccatgatcccgacgtcatcatcggttggagcgtgctgcag
ttcgacatccgcgtgctccacgaacacgcgcgcaaactgggcgtgcccctgcacctgggg
cgtggtgcactggaggacgatcgctacgaacccggcggccagggccggcaattccaggcg
ctgctggccggacggccgatcatcgatggggtggaggcgctcaagtcggcgacctgggtg
tttccttcctacagcctggagaacgtcagccgcagcctcctgggcgaaggcaaggccatc
gacaatccccacgaccgcatggcctccatcaaccgcatgttcgcgggcgagaagagcgcc
ctggcgcgctacaacctggtggactgcgaactggtcacccgcatcttcgccaagaccgag
ctgctgcgcttcctgctggaacgggccagcgtcaccggcctgccgctggagcgccatggc
gcctccatcgccgccttctaccacctctatctgccgctgatgcaccgccagggcttcgtc
gcccccagtctcggtgcccagccgcccgaggccagcccgggcggcttcgtcatggattcc
cggcccgggctctacgattcggtactggtgctggactacaagagcctctatccctcgctg
atccgcacctttctcatcgatccggtgggcctggtggaggggctggcgctatccgaggac
gagaccgtgccgggctttcgcggcgcgcgtttccatcgcacccggcattgcctgccggag
atggtggcgcgggtctgggaaggccgtgacgccgccaagcgtgccggcaacgcgcccctg
gcccaggcgctgaagatcatcatgaacagcttctacggggtgctgggcacgccgcactgc
cgcttcttcgatcaccgcctggcctcgtccatcaccctgcgcggccacgcggtgatgcac
cagacccgcgagctgattgaggcgcgtggccatcgggtcatctatggcgacaccgactcc
accttcgtctggctcggggctgcccatgaggaggccgaggccgagcgtatcggtcgcgag
ctggtggcggcggtcaacgcccactggcgcgagcggctacaggcggagctggggctggaa
agccatctggagctgcagtacgagacccacttcagccgctttctcatgcctaccatccgc
ggcgcggaggagggcagcaagaagagatacgccgggctcaggcccggagccgacggccag
cccgagctggtgttcaagggcctggaaacggtgcgcagcgactggtcgccgctggcccag
cgcttccagcgtgagctgtacctgcgcatcttcaccggcgaaccgcacgaggactacgtg
cgcgacttcgtcgcccgaacccgcgccggcgacttcgacgacctgctggtctatcgcaag
cgcctgcgccgacctctggaagagtaccagagcaacctttcgccgcaggtccgcgccgca
cgcctgctggaggcggaaaacgcccggctgggacgccgcaggcgctttcgccgtggcggc
tggatcagctacctgatcaccaccgccggtgccgaaccggtcgagctgccccatgcgccg
cccgactacgaccactatgtacagcgccagctggcgccggtggccgacgccatcctgccc
ttcgttggcgaccgcttcgaccgactgctggatcggcaaatggggttgttctga

DBGET integrated database retrieval system