KEGG   Pseudomonas oryzihabitans: APT59_19780Help
Entry
APT59_19780       CDS       T04267                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00010  Glycolysis / Gluconeogenesis
por00071  Fatty acid degradation
por00350  Tyrosine metabolism
por00625  Chloroalkane and chloroalkene degradation
por00626  Naphthalene degradation
por01100  Metabolic pathways
por01110  Biosynthesis of secondary metabolites
por01120  Microbial metabolism in diverse environments
por01130  Biosynthesis of antibiotics
por01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APT59_19780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT59_19780
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    APT59_19780
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APT59_19780
   00626 Naphthalene degradation
    APT59_19780
Enzymes [BR:por01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APT59_19780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ALZ86334
UniProt: A0A0U4P7G1
LinkDB All DBs
Position
4350149..4351180
Genome map
AA seq 343 aa AA seqDB search
MPKTMKAAVVTAFGKPLEFREVEVPTPGAGQVLVKIAASGVCHTDLHAAQGDWPVKPNPP
FIPGHEGVGHVVAVGAGVTHVKEGDRVGVPWLYSTCGHCEHCLGGWETLCESQQNTGYSV
NGGFAEYTLADAGYVGRLPDNVGFVEIAPILCAGVTVYKGLKMTDTKPGNWVVISGIGGL
GHMAVQYARAMGLNVAAVDVDDKKLDLARRLGAEVTVNAREQDPAAYLKKEIGGAHGALV
TAVSPKAFEQAIGMTRRGGTIALNGLPPGDFPLSIFDMVLNGTTVRGSIVGTRLDLQEAL
DFAGEGKVKATVSAEPLENINDIFARMHEGGIEGRVVIDMALS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaacaatgaaagccgctgtcgtcaccgcctttggcaaacccctggaattccgc
gaagtcgaggtgcctaccccaggcgccggccaggtactggtcaagatcgccgccagtggc
gtctgccacaccgatctgcatgccgcccagggcgactggccggtcaagcccaatccgccc
ttcatccccggtcacgaaggcgtcggtcatgtggtggcggtgggcgccggggtcacccat
gtcaaggaaggcgaccgggtcggggtgccctggctgtattccacctgtggccattgcgag
cactgcctgggtggctgggagaccctctgtgaatcccagcagaacaccggctactcggtg
aacggcggcttcgccgaatacaccctggccgatgccggctacgtcggccgcctgccggac
aacgtcggcttcgtcgagatcgcgcccatcctctgcgccggggtcaccgtctacaagggc
ctgaagatgaccgacaccaagccgggcaactgggtggtgatctccggtatcggcggcctg
ggccacatggcggtgcagtacgcccgggccatgggcctgaacgtggcggcggtggatgtg
gacgacaagaagctcgacctcgcccgccgactgggcgccgaggtcacggtcaatgcccgc
gagcaggacccggcggcctacctgaagaaggagatcggcggtgcccacggcgccctggtc
acggcggtctcgcccaaggccttcgagcaggccatcggcatgacccgtcgcggtggcacc
attgccctcaacggcctgccgccgggtgacttcccgctgtcgatcttcgacatggtgctc
aacggcaccacggtgcgcggttccatcgtcggcacccgcctggacctgcaggaggccctg
gacttcgccggcgaaggcaaggtcaaggccacggtgagcgccgagccgctggagaacatc
aacgacatcttcgcccgcatgcatgaaggcggcatcgagggtcgagtggtgatcgacatg
gcgctgagctga

DBGET integrated database retrieval system