KEGG   Porphyrobacter sp. LM 6: BG023_111294Help
Entry
BG023_111294      CDS       T04468                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
porl00473  D-Alanine metabolism
porl00550  Peptidoglycan biosynthesis
porl01100  Metabolic pathways
porl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:porl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BG023_111294
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BG023_111294
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BG023_111294
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:porl01011]
    BG023_111294
Enzymes [BR:porl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BG023_111294
Peptidoglycan biosynthesis and degradation proteins [BR:porl01011]
 Precursor biosynthesis
  Amino acid ligase
   BG023_111294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOL94231
UniProt: A0A1D7NK98
LinkDB All DBs
Position
1351808..1352803
Genome map
AA seq 331 aa AA seqDB search
MSFDKPLHVAVLMGGWANERPVSLTSGAGVADALESKGHRVTRIDMGRDVAQRLAEAKPD
VVFNALHGVPGEDGTVQGMLDLMGLAYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGRI
VTREELYERDPLPRPYVLKPVNEGSSVGVAIVTADSNVGNPISPDARGPWQEFAELLAEP
FIKGRELTAAVLDGPDGPRALGVTELVVANGFYDYENKYTAGRTEHIFPAKLPPEITALC
EQYAVKAHQVLGCHGTSRTDFRWDEEAGEDGLFVLETNTQPGMTPLSLVPEQAAGCGIPY
ADLVELLVAEALRVHAMKQRKGGGDGAADPA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcgacaaacccctccacgtcgccgtcctgatgggcggctgggcgaatgaacgt
ccggtctcgctgaccagcggcgcgggtgtggcggacgcgctggagagcaagggccaccgc
gtcacccgcatcgacatgggccgcgatgttgcccagcggcttgccgaggcgaagcccgac
gtggtgttcaatgcgctccacggcgttcccggcgaggacgggacggtgcagggcatgctc
gacctgatgggccttgcctatacccattcgggcctcgccacctcggtgatcgcgatcgac
aagcagctgaccaagcaggcgctggtgccgcacggcatccccatgcccggcgggcggatc
gtgacgcgcgaggaactctacgagcgcgacccgctgccgcgcccctatgtgctcaagccc
gtcaatgaaggctcctcggtcggcgttgcgatcgtcacggcggacagcaatgtcggcaac
ccgatttctccggacgcgcgcgggccgtggcaggagtttgccgaactgctcgccgaaccc
ttcatcaagggccgcgaactgaccgccgccgtgctcgatggccccgatgggccgcgggca
ttgggcgtgaccgaactcgtcgtcgccaacggcttctacgattacgagaacaagtacacc
gccgggcggacggagcacatcttccccgccaagctgccgcccgaaatcaccgcgctgtgc
gaacaatatgcggtgaaagcgcaccaggtgctcggctgccacggcaccagccgcaccgat
ttccgctgggacgaggaagcgggcgaggacggcttgttcgtgctcgaaaccaacacccag
ccggggatgaccccgctcagtctcgtgcccgaacaggcagcgggctgcggcattccctat
gccgatctggtcgaattgctggtggccgaggcgctcagggtgcacgcgatgaagcaacgc
aagggaggcggcgatggcgcagcagatccggcgtag

DBGET integrated database retrieval system