KEGG   Porphyrobacter sp. LM 6: BG023_112725Help
Entry
BG023_112725      CDS       T04468                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferasesubunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
porl00970  Aminoacyl-tRNA biosynthesis
porl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:porl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BG023_112725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:porl03029]
    BG023_112725
Enzymes [BR:porl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BG023_112725
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BG023_112725
Mitochondrial biogenesis [BR:porl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BG023_112725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AOL95634
UniProt: A0A1D7NPC8
LinkDB All DBs
Position
complement(2788836..2790332)
Genome map
AA seq 498 aa AA seqDB search
MSNYRIQGATGEWEVVIGLEVHAQVTSNSKLFSGAATAFGAEPNSQVSLVDAAMPGMLPV
PNRECIRQAVRTGMAIEAQINAWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSLLIEAD
EKAGIPEDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSKPDMRSPAEA
GAYLRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKVGEPFGTRTETKNVNSVRFVMQAI
EHEAMRQVDVLEAGGSVVQETRLFDPGTGTTRTMRSKEDAHDYRYFPDPDLLPLVLEEDF
LAECRASLPELPDAKRKRYVEVLGLTPYNARELTAEVETFARFETLLAETAKVIGKDEAK
VATQVANWSLSVAPGVMKALGDEADAANATAAAQAAILAMQEKGEISGGQAKEIFEIVLK
TGRDPSEIAEAEGLKQVSDTGAIEAAVDAIIAANADKVEQYRGGKEALFGFFVGQTMKAM
QGKANPAVVNQLLKDKLG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactaccgcattcagggtgccacgggcgaatgggaggtcgtgatcggccttgaa
gtccacgcgcaggtcacctcgaactccaagctgttcagcggcgcagcgaccgctttcgga
gcggagccgaactcacaggtctccctcgtcgatgccgcgatgccggggatgctgccggtg
cctaaccgcgagtgcatccgtcaggcggtgcgcaccggcatggccattgaagcgcagatc
aacgcgtggtcgcgttttgaccgcaagaactacttctacgccgatcttccgcagggctac
cagatcagccagctttatcatccgcttgtgggcgaaggctcgctgctgatcgaggcggac
gagaaggccggcattcccgaagacaaggtcatcgggatcgagcgcattcacgtggagcag
gatgcgggcaagctgatgcatgatcagcacccgaccatgtcctatgtcgacctcaaccgc
tcgggcgtggcgctgatggagatcgtctccaagcccgatatgcgttcgcccgccgaagca
ggggcttacctcaggaagctgcgggcgatcctgcgctatgtcggctcgtgcgatggcaac
atggaagaaggctcgatgcgcgccgacgtgaacgtctcggtgcgcaaggtgggcgagccc
ttcggcacccgcaccgagaccaagaacgtgaactccgtgcgcttcgtcatgcaggcgatc
gagcacgaggcgatgcgtcaggtcgatgtgctcgaagcgggcggcagcgtggtgcaggaa
acccgcctgttcgaccccggcaccggcaccacgcgcacgatgcggagcaaggaagacgcg
cacgattatcgctacttccccgatcccgatctgctgccgctggtgctggaggaagacttc
cttgccgaatgccgcgcctcgctccccgaactgccggatgccaagcgcaagcgctatgtc
gaggtgctgggcctcaccccctacaacgcccgcgaattgaccgccgaggtcgaaaccttc
gcgcggttcgagacgctgctggccgaaacggccaaggtgatcggcaaggacgaagccaag
gtagccacgcaggtcgccaactggtcgctctcggtcgcgccgggcgtgatgaaggcgctg
ggcgatgaagctgacgccgccaacgccacagctgccgcgcaggctgccatcctcgcgatg
caggaaaagggcgaaatcagcggcgggcaggccaaggagatcttcgagatcgtcctcaag
accggccgcgatccgtctgaaatcgccgaggctgaggggctgaagcaggtctccgacacc
ggcgcgatcgaagctgcagtcgatgcgatcatcgccgccaacgccgacaaggtcgaacag
taccgcggcggcaaggaagcgctgttcggcttcttcgtcggccagacgatgaaggcgatg
cagggcaaggccaaccccgcggtggtgaaccagctgctcaaggacaagctgggctaa

DBGET integrated database retrieval system