KEGG   Porphyrobacter sp. LM 6: BG023_11672Help
Entry
BG023_11672       CDS       T04468                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
porl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:porl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG023_11672
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:porl02000]
    BG023_11672
Enzymes [BR:porl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BG023_11672
Transporters [BR:porl02000]
 Other Transporters
  Pores ion channels [TC:1]
   BG023_11672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C GST_N Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AOL93625
UniProt: A0A1D7NIM3
LinkDB All DBs
Position
671334..672038
Genome map
AA seq 234 aa AA seqDB search
MTDSRPDLVIYGSPLSPFVRKVAAVCIEKGVPYEIEAINVFDPPAWFRDISPMKRIPVLR
DRSVAEEGVAGTIADSSAICAFIEKKHPAPALYPEAPMALGEALFIEEYADTALAMAGGL
GIFRPIFFAVSKGEALGLDKAREAWSTQVPPILDVLEARLAGRAFFAGDALSIADITVAT
VLMQITLVADVSLERWPGLAAHLAAMQARPSIAGPYAAAQKVVRKALPDACDLT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgactgattcccgccccgatctggtgatctatggcagcccgctgtcgcccttcgtccgc
aaggtcgccgcggtgtgcatcgaaaagggcgtgccttacgagatcgaggcgatcaacgtg
ttcgatccgcctgcgtggttccgcgatatctcgccgatgaagcgtattccggtgctgcgt
gatcgttcggtggcggaagagggcgtggcgggcaccatcgccgacagctcggccatctgc
gcctttatcgagaagaagcatcccgcccccgcgctctatcccgaagccccgatggcgctg
ggcgaggcgctgtttatcgaggaatatgccgataccgcgctggcgatggcgggcgggctg
ggcatcttccggccgatcttcttcgcggtaagcaagggcgaggcgctggggctcgacaag
gcgcgcgaggcgtggagcacgcaggtgccgccgatcctcgatgtgctcgaagcgcggctg
gcgggccgagcgttctttgccggcgatgcgctgtcgattgccgatatcaccgtggccacc
gtgctgatgcagatcaccctggtggccgacgtttcgcttgagcgttggccgggtctggca
gcgcatctggccgcgatgcaggcgcgcccttcgatcgccgggccttacgcggcggcgcaa
aaggtcgttcgcaaggccttgccggatgcttgcgacctgacctaa

DBGET integrated database retrieval system