KEGG   Porphyrobacter sp. LM 6: BG023_11785Help
Entry
BG023_11785       CDS       T04468                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
porl  Porphyrobacter sp. LM 6
Brite
KEGG Orthology (KO) [BR:porl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BG023_11785
Enzymes [BR:porl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BG023_11785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like K_oxygenase Thi4 FAD_binding_3 NAD_binding_8 FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AOL93734
UniProt: A0A1D7NIW2
LinkDB All DBs
Position
complement(793064..794653)
Genome map
AA seq 529 aa AA seqDB search
MLDAAMQAQLKQYLGNLREGVELVASLDDSEKSRQTRQLIEQIAALHDLVTARFDGTDAR
KPSFVIRRASDANKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQVRALEGDYN
FEMFFSLSCHNCPDVVQALTLMALENPRIHATLIEGGTFQEEVERRDIMAVPATFLNGEP
FYNGKMELAEILSRLDKNADAKQAEKLAAKAPFEVLVVGGGPAGAAAAVYTARKGFRTGI
AAERFGGQLMDTLGIENLPGTPYTEGPKLTDSLKQHVGEYDIDLMDLARAVELRAAKDVG
GYHEVVMANGATLRARSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAMIVGHVTLIEFDTKLRADEVLQRKLRSMANVEIITNGQTTEILGE
NGKVSGLVVKNRANGDERRIELEGVFVQIGLVPNTEWLRETGLELSKFGEIVIDDHGATN
IPGIYAAGDCTTVPHKQIVVAMGEGAKAGLGAFDFLIRNEPVEDIAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccgccatgcaggcacagctcaagcaatatctcggcaatttgcgcgaaggc
gtggaactggtcgcctcgctcgatgacagcgagaagtcgcgccagacccgccagctgatc
gaacagatcgccgcgctgcacgatctcgtcaccgcgcgtttcgatggcaccgatgcgcgc
aagcccagcttcgtgatccgccgcgcatcggacgcgaacaagtgggtgcgctttgccggc
ctgccgatgggccacgagtttacctcgctggtgctcgcgctgctgtgggcgggcggccat
ccgcccaaggtcgatgccgatctgatcgagcaggtccgcgcgcttgaaggcgattacaat
ttcgagatgttcttctcgctgtcgtgccacaactgccccgatgtggtgcaggcgctgacg
ctgatggcgctcgaaaacccgcgcatccacgcgacgctgatcgaaggaggcaccttccag
gaggaagtcgagcgccgcgacatcatggccgtgcccgcgaccttcctcaacggggagccg
ttctacaacggcaagatggaactggccgaaatcctcagccgtctcgacaagaatgccgac
gccaagcaggctgaaaagcttgcggccaaggcgccgttcgaggtgctggtggtcggcggc
ggcccggcaggtgcagcggcggcggtctataccgcacgcaagggcttccgcacgggcatc
gcggccgagcgcttcggcgggcagctgatggatacgctcgggatcgagaacctccccggc
acgccttacaccgaagggccgaagctgaccgacagcctgaagcaacacgtcggcgaatat
gacatcgacctgatggacctcgcccgagcggtcgaactgcgcgccgccaaggacgtcggc
ggttatcacgaggtggtgatggccaacggcgcaaccctgcgcgcccgttcgctgatcctc
tcgaccggtgcgcgctggcgcaatctcggcgtgccgggcgaagcggagtatcgcaacaag
ggcgtggcctattgcccgcactgtgatggcccgctgttcaagggcaagcgcatcgcggtg
atcggcggcggtaactccggcgtcgaggcggcgatcgaccttgcgatgatcgtcggccac
gtcaccctgatcgagttcgacaccaagctgcgcgccgacgaagtgctccagcgcaagctg
cgctcgatggccaatgtcgagatcatcaccaacggccagaccaccgagatcctcggagag
aacggcaaggtcagcggcctcgtggtcaagaaccgcgccaacggcgatgaacgccgcatc
gaactcgaaggcgtgttcgtgcagatcggcctcgtccccaacaccgaatggctgcgcgag
acgggtctcgaactgtcgaagttcggggagatcgtgatcgacgatcacggcgcgaccaac
atccccggcatctacgccgcgggcgactgcaccaccgtgccgcacaagcagatcgtcgtc
gccatgggcgaaggcgcgaaggcaggccttggggcgttcgacttcctgatccgcaacgaa
ccggtcgaggatatcgccgaggcagcctag

DBGET integrated database retrieval system