KEGG   Polaromonas sp. SP1: DT070_04580Help
Entry
DT070_04580       CDS       T05689                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00564  Glycerophospholipid metabolism
pos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DT070_04580
Enzymes [BR:pos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DT070_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like 3HCDH_N Pyr_redox GIDA NAD_binding_8 Lycopene_cycl Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AYQ27373
LinkDB All DBs
Position
complement(959853..961439)
Genome map
AA seq 528 aa AA seqDB search
MTTEFAPAATRRQDLMARVAEPRHYDVAIIGGGATGLGVALDAAARGFSVILVESHDFAK
GTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLANAPHLAQPLAFVMPSYKFWEAPF
YGIGLKMYDALAGKAGLGATEFLSRRETQACLPTVQAQDLKGGVKYWDGQFDDARLALAL
ARTAARQGALLVNYCAATGLIHENGKLVGLHASDQETGRTFDIRASCVVNAAGVWVDQLR
LQDGQAIGRDPKPMVAPSQGVHIVVDRSFLPTDHAMLIPKTADGRVLFAVPWLGKTILGT
TDTPRHDLAREPLPFREEVDFILRESARYLSRAPGPADIKSIWVGLRPLVKPPDDDAGST
QALSREHTVLVSKSGLVTVTGGKWTTYRAMAEDVLDKCFAAALLPSRPNGATTQLKLVGA
HNSGHTISEAPGAHLYGSDAPAMESLPGAGRELGGGLTEAMVRFAARYEYARCVEDVLAR
RSRLLFLDAALARTLAPAVAKLLQEENGVDPQLDAFVLLCSQYLSLPD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgaattcgcgcctgccgccacacggcgccaggacctgatggcccgcgtggcc
gagccgcgccactacgacgtcgccatcatcggtggcggcgccaccggcctgggcgtggcg
ctggatgccgctgcgcgcggcttctccgtgatcctggtcgaatcgcacgactttgccaaa
ggcacttcgtcccgcgccaccaagctggtgcacggcggtgtgcgttacctggcgcagggc
aacatttcgctggtgcgcgaggccttgcacgagcgcaccacgctgctggccaatgcgccg
cacctggcgcagccgctggcgtttgtgatgccctcctacaagttctgggaagcgccgttt
tacggcatcgggctcaagatgtatgacgccctggccggcaaggcgggcctgggggcaacg
gaattcctcagccggcgtgaaacgcaggcttgcctgccgacggtgcaggcgcaagacctc
aagggcggcgtcaagtactgggacggccagttcgacgacgcgcggctggccctggcgctg
gcccgcacggcggcacgccagggcgcgctgctggtgaactactgcgccgccacggggttg
atccatgaaaacggcaagctcgtcggcctgcatgcgagcgaccaggaaacggggcgcacc
tttgacatcagggcgagctgcgtggtgaatgcggccggcgtctgggtggaccagctgcgc
ctgcaggacgggcaggcaataggccgcgaccccaaacccatggtggcgcccagccagggc
gtgcacatcgtggtcgaccgctcctttttgcccaccgatcacgccatgctgatccccaaa
acggccgacgggcgggtgctgtttgcagtgccctggctgggcaagaccattctgggcacc
accgacaccccacgccatgacctggcgcgcgagccgctgcctttcagggaagaggtcgat
ttcatcctgcgcgagtcggcacgttacttgagccgcgctccgggcccggcggatatcaaa
agcatctgggttggcctgcgcccgctggttaaaccgccggacgacgacgccggcagcacc
caggcgctgtcgcgcgaacacaccgtgctggtcagcaaaagcggcctggtcacggtgacg
ggcggcaaatggactacctaccgggccatggcagaggatgtgctggacaagtgttttgcc
gcggccttgctgccgtcgcgcccgaatggcgccaccacgcaattaaagttggttggtgct
cacaattcgggtcacacgatcagcgaagcgcccggggctcatttatatggaagcgatgcc
ccggccatggaaagcctgccaggcgccggccgtgaactgggcggcgggctgaccgaagcc
atggtgcgctttgccgctcgttatgaatatgcgcgctgcgtagaggacgtgttggcgcgc
aggtcccgcctgttgtttctggatgccgcgctggccagaacgctcgcacccgccgtcgca
aagctgctgcaagaggaaaacggggtggatccgcagctggacgcatttgtgttgctttgc
agccaatatctgagcttgcccgattga

DBGET integrated database retrieval system