KEGG   Polaromonas sp. SP1: DT070_06585Help
Entry
DT070_06585       CDS       T05689                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00480  Glutathione metabolism
pos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DT070_06585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pos02000]
    DT070_06585
Enzymes [BR:pos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DT070_06585
Transporters [BR:pos02000]
 Other Transporters
  Pores ion channels [TC:1]
   DT070_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_2 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AYQ27721
UniProt: A0A3G3G8S7
LinkDB All DBs
Position
1368152..1368760
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHITLHESGLKFEHVAAPTKTHQLEDGTDYYTINPLGYVPLLELDDG
TRIAEGPAIVQYIADQVPEKKLAPANGTLERYKMQSWLTFIGTELHKGFSPLFNAATPAE
YKTIVIDKLLSRLKWVDGQLAGKQYLMGDAFSVADPYLFTVTNWAPRVGVDISGFANIAA
FRERMAARPAVQAAMKHEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattactcccccggcgcctgctcactgtcaccccacatcacgctgcatgag
tcaggcctgaagttcgaacacgtggcggcgcccaccaaaacccaccagctggaagacggc
accgactactacaccatcaacccgctgggttatgtgcccctgctggagctggacgacggc
acccgtatcgccgaaggcccggccatcgtgcagtacatcgccgaccaggtgcccgagaaa
aaactggcgccggccaacggcacgctggagcgctacaagatgcagtcatggctgaccttt
atcggcaccgaactgcacaagggcttcagtccgctcttcaacgccgccacgccggccgaa
tacaaaaccatcgtgatcgacaagctgctgtcgcgcctcaaatgggtggacggccagctg
gccggcaagcaatacctgatgggcgacgccttcagcgtggcggatccttacctctttacg
gtgaccaactgggcgccgcgggtgggggtggatatttcggggtttgcgaatattgcggcg
tttcgggagcggatggcggcccggccggctgttcaggccgcgatgaaacacgaaggactg
ctgaagtaa

DBGET integrated database retrieval system