KEGG   Polaromonas sp. SP1: DT070_07630Help
Entry
DT070_07630       CDS       T05689                                 

Definition
(GenBank) CHASE2 domain-containing protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pos  Polaromonas sp. SP1
Brite
KEGG Orthology (KO) [BR:pos00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pos01001]
    DT070_07630
Enzymes [BR:pos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DT070_07630
Protein kinases [BR:pos01001]
 Serine/threonine kinases: Other
  Bacterial family
   DT070_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase CHASE2 Pkinase_Tyr APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: AYQ27898
UniProt: A0A3G3G915
LinkDB All DBs
Position
1594401..1597130
Genome map
AA seq 909 aa AA seqDB search
MAKSSRKLSQFWRADWFVGVLVVLAVLFLHGLTDFFGTLERRYYDFASTSTSRQPSDRIA
IIAIDDQSIANIGRWPWPRDVHAQLIDQLSAAKAKTIAHTAFFFEPQTDRGLVFIRKIKE
ALGPVADPAAPPQGGLPEQLGKVIAEAEVALDTDAKLAASMTKAGNVLVPSVFSLGVPQG
RPDNPLPAYALKSAVDEPNGFSLPAIRGQQPIELIGAAAAGIAHLNQLPDVDGAVRQEPL
LINYYGKAVPSMSLLAAARSLNLGPADIKLNVGESVQIGKLMVKTDESALMLPQFYKGKD
GRPAFAVDSFYDVISGKIPASKYADKIVIIGATAAGVGTQFPTPAGPGLSPAETIAHITS
SILSEHFIVQPGWGVWATLGVLLLVAGYLIAGLPRLSAGKAAIVTLVLFVLLLVIEFGLL
SASATWLKFVFPAALLVIGHLALTTKRFLMTEAGKLKSDEESAETNRMMGLALQGQGQLD
MAFDRFRRVPFTDALMDNMNNLALDFERKRQFNKAQAVYEYMATYNKNHKDLQSKLNRAK
NLSETVILGGGGSHPGGTMLLDGGAVEKPMLGRYQVEKELGKGAMGVVYLGKDPKIGRVV
AIKTMALSQEFEGEELDDARERFFREAETAGRLQHQNIVTIFDAGEEHDLAYIAMEFLKG
KDLADVTKDGSLLPVPKVLSIVARVAEALAYAHKQNVVHRDIKPANIMYEIDSDTVKVTD
FGIARITDSSKTKTGLVLGTPSFMSPEQIAGKKVDGRSDLYSLGVMLFQMLAGVLPFRGD
SMAELMYKIANEEAPDIRIIRKELPARLAEVVALSLAKQPESRYQDGDRFAADLRDVIAG
LGAGATASSYAAPVVAAAARFDTTVVQAAAGQAPEPRAYDATQVLKTEGAQTFDKTIVSK
PPVADTDTQ
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaatcatctagaaagttgagtcagttctggcgggccgactggtttgttggcgtt
ctcgtcgttctggccgtccttttcctgcacggcttgacggactttttcggcaccctggag
cgccgttactacgacttcgccagtacaagcacctcacgccagccttcggatcgcatcgcc
atcatcgcgatcgacgaccaaagtattgccaatattgggcgctggccctggcctcgcgac
gtgcatgcgcagctgattgaccagctgtcggctgccaaagccaaaacgattgcgcatacc
gcctttttctttgagcctcagacagaccgcgggctggtgtttatccgcaaaatcaaagag
gcgctcggtccggttgcggatccggcggcgcccccccagggcggcttacccgagcagctt
ggcaaagtgattgccgaggccgaagttgccctggataccgatgccaagctcgcagccagc
atgaccaaagcgggcaatgttctggtaccttcggttttttcgctcggtgtgccgcagggc
cggccagacaacccgctgccggcgtatgccttgaaaagtgccgtggacgaacccaacggc
ttctccctcccggcaatacgtggacagcagcccatcgaactgattggcgcagcggcggcg
ggcatcgcccacctcaaccagttgcccgatgtggatggcgcggtgcgtcaagaacccctg
ctgatcaactattacggcaaggccgtgccttccatgagcttgctggctgcggccaggagc
ctgaatctcgggcccgcggacatcaagctcaacgtcggcgaatctgtacagatcggcaag
ctgatggtcaaaaccgacgagtcggccctgatgcttccgcagttctacaagggcaaggac
ggccgccctgcctttgcagtggattcgttttacgacgtgatttccggcaagattccggcc
agtaaatacgccgacaagattgtgatcatcggcgccaccgccgcgggcgttggcacccag
ttcccgacgcctgcgggcccggggctttcgcccgcagagaccattgcgcacatcacgtcc
agcatcctgagcgagcatttcatcgtgcagccgggatggggtgtttgggccacgctaggc
gtgttgttgctggtggccggttatttaattgccggattgcccaggctttcggcgggtaag
gctgccatcgtcacgctggtgctgtttgtgctgctgctggtgattgagttcggtctgctg
tcggcctccgcaacctggctcaagtttgtctttcctgcggcacttttggtgatcgggcac
ctggcattgaccaccaagcgtttcctgatgaccgaagcgggcaagctcaagtcggacgag
gagtcagccgaaaccaaccgcatgatgggcttggcgctgcaaggccagggccaacttgac
atggctttcgaccgtttccggcgcgtacctttcaccgatgccctgatggacaacatgaac
aaccttgcgctcgatttcgagcgcaagcgccagttcaacaaagcccaggccgtgtacgaa
tacatggccacctacaacaaaaaccacaaggacttgcagtccaagctcaaccgcgcgaag
aacctctctgaaaccgtcattctgggcggcggcgggtcccaccccggcggcaccatgctg
cttgacggaggcgctgtcgagaagccgatgctgggccgctaccaggttgaaaaagagctt
ggcaagggtgccatgggcgtggtttaccttggcaaggatcccaagattggccgcgttgtg
gccatcaagaccatggccctgagccaggagttcgaaggcgaggagctcgacgacgcgcgt
gaacgcttcttccgtgaggctgaaacggccggccggttgcagcaccagaacatcgtgacc
atcttcgacgcgggtgaagagcacgacctggcgtacatcgccatggaattcctcaagggc
aaggacctggccgacgtcaccaaagacggcagcctgctgcccgtacccaaggtgttgtcc
atcgttgcccgggtggcggaagccctggcctatgcgcacaagcagaacgtggtgcaccgg
gacatcaagccggccaacatcatgtatgagatcgacagtgatacggtaaaggtgaccgat
ttcggcatcgcccgcattacggattcgagcaaaaccaagacgggcctcgtactgggtaca
cccagcttcatgtcgcccgagcagattgccggtaaaaaagtcgacgggcgttcggacctg
tactcgctgggcgtcatgttgttccagatgctggcgggcgtgttgcctttccggggcgac
tccatggccgaattgatgtacaaaatcgcgaatgaagaagcgccagatatccggatcatc
cgcaaggaattgcctgcacggctggctgaagtcgttgcgctttcgctggccaagcagccg
gaatcacgctatcaggatggtgaccggtttgccgccgatttgcgtgacgtcatcgccggg
ctgggagcgggcgccacggcatcttcctatgccgctccggtggttgctgctgcggcccgg
tttgataccacagtggtccaggctgccgcgggacaggcgccggagcccagggcctatgat
gcgacccaggtcctgaaaacagagggagcgcagacgttcgacaaaaccatcgtctccaaa
ccccctgttgccgatacagacacccagtga

DBGET integrated database retrieval system