KEGG   Polaromonas sp. SP1: DT070_12240Help
Entry
DT070_12240       CDS       T05689                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00520  Amino sugar and nucleotide sugar metabolism
pos01100  Metabolic pathways
pos01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DT070_12240
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DT070_12240
Enzymes [BR:pos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DT070_12240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AYQ28725
UniProt: A0A3G3GBG6
LinkDB All DBs
Position
2595128..2596186
Genome map
AA seq 352 aa AA seqDB search
MTQHAPLIIDIAGTALTKADRRRLKHPLTGGIILFGRNWKDRRELSELCLEIKDIREDLL
ICVDHEGGRVQRFRTDGFTHLPPMRELGNLWMKDQLAATNAATACGYVLGAELRASGVDF
SFTPVLDLDYGESGVIGDRAFGRDPRVVTLLAKSLMHGLLQAGMANCGKHFPGHGFVKAD
SHTDIPVDKRSLKAILADDAAPYEWLNTTLSSVMPAHVIYPKVDARPAGFSSQWLNFILR
SQLGFGGAIFSDDLSMAGARLIDGKEVSYTEAAVTALTAGCDMVLLCNQSVGDGQPVDEL
LDGMAEALLKGQWEAMEASELRRLALLPQGRAFGWDELMVQPAYMHALGLVP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcacgcccccctcattatcgacatcgccggcaccgcactcaccaaggccgac
cgccggcgcctgaaacacccgctcaccggcggcattattttgttcggccgcaactggaaa
gaccggcgcgaactcagcgaactgtgcctggagatcaaagacatccgtgaagacctgctg
atctgcgtcgaccacgaaggcggccgtgtgcagcgcttcaggaccgacggcttcacccac
ctgccgcccatgcgcgaactcggcaacttgtggatgaaagaccagctggcggccaccaat
gccgccaccgcctgcggttatgtgctgggcgccgagctgcgcgcctcgggcgtcgacttc
agcttcacgcctgtgctcgacctggattacggcgaaagcggcgtcatcggcgaccgcgct
ttcgggcgcgacccgcgcgtcgtcaccttgctggccaaaagcctgatgcatggcttgctg
caagccggcatggccaattgcggcaaacactttcccggccacggtttcgtcaaggccgac
tcccacaccgacatccccgtggacaaacgcagcctcaaagccatcctggccgacgacgcc
gcgccttacgaatggctcaacaccacgctcagcagcgtgatgcccgcccacgtgatctat
cccaaggtagacgcccgcccggccggcttttcaagccagtggctgaacttcatcctgcgc
agccagctcggttttggcggcgcgattttcagcgacgacctcagcatggccggcgcccgg
ctgatcgacggcaaagaggtgagctacaccgaagcggccgtgacggcgttgaccgccggc
tgcgacatggtgctgctgtgcaaccagtcggtcggcgatggccagccggtggacgagctg
ctcgacggcatggccgaggcgctgctcaaaggccagtgggaggcgatggaagccagcgag
ctgcggcggctggccttgctgccgcagggcagggcgttcggctgggacgagctgatggtg
cagccggcgtacatgcatgcgctggggctggttccctga

DBGET integrated database retrieval system