KEGG   Polaromonas sp. SP1: DT070_14885Help
Entry
DT070_14885       CDS       T05689                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pos  Polaromonas sp. SP1
Brite
KEGG Orthology (KO) [BR:pos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DT070_14885
Enzymes [BR:pos01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DT070_14885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin FAD_binding_3 DAO HI0933_like Thi4 AlaDh_PNT_C NAD_binding_7 K_oxygenase FMO-like Thioredoxin_4 DUF2795 DSBA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AYQ29193
UniProt: A0A3G3GCX5
LinkDB All DBs
Position
complement(3128148..3129719)
Genome map
AA seq 523 aa AA seqDB search
MLDDATKAQLKSYLERATQPIEIVASLDGSEASGEVLSLLKDVAESSPLVKLTESRDDPH
RKPSFSINRPGENHGPRFAGLPMGHEFTSLILALLQIGGYPPKVEQPVLEQIRALDGDFD
FEVYVSLTCHNCPDVVQALNLMAVQNPRIKTTMIEGGTFQDEVKEREIMGVPTVFLNGTM
FGNGRMSLEEILAKIDTSGVEREAKIIDKKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTLGIENFISIKETEGPKFAHALEEHVRNYDVDIMNLQRAKALVPNSGPD
KNLIEVQLESGASLKSKSIVISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGIVGHVTLIEYDTALRADAVLQRKLNSLENVTVFTNAQTTEITG
DQKVNGLVYKDRASGELKTVELEGVFIQIGLVPNTDWLKGVVELSKHGEIIVDAKGQTSV
PGVFAAGDATTVPFKQIIIAAGEGAKAALSAFDYLIRSPIAAQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacgccaccaaagcccaactgaaaagctatctcgaacgcgccacgcagccg
attgaaatcgtcgcttcgcttgacggcagcgaggcttcgggtgaagttctgtcgctgctg
aaagacgtggccgagtcctcgccgctggtcaagctgaccgagagccgcgacgacccgcat
cgcaagccctctttctcgatcaaccgccccggtgagaaccacggcccgcgttttgccggc
ctgcccatgggccatgaattcacctcgctgatccttgcgttgctgcagatcggcggctac
ccgcccaaagtcgagcaacccgtgctggagcagatccgcgcgctcgatggcgacttcgac
ttcgaggtgtatgtctcgctgacctgccacaactgccccgatgtcgtccaggcgctgaac
ctgatggcggtgcagaacccgcgcatcaagaccacgatgatcgaaggcggcaccttccag
gacgaagtgaaggagcgggagatcatgggcgtgcccaccgtcttcctgaacggcaccatg
ttcggcaacggccgcatgagcctggaagaaatcctggccaagatcgacaccagcggcgtc
gagcgcgaagccaagatcatcgacaaaaaagaccccttcgacgtgctgatcgtcggcggc
ggccctgccggcgcggcagcggccgtgtatgccgcgcgcaagggcattcgcaccggcgtg
gcgtccgagcgcttcggcggccaggtgctggacaccctgggcatcgagaacttcatctcc
atcaaggaaaccgaaggccccaagtttgcccacgcactggaagagcacgtgcgcaactac
gacgtggacatcatgaacctgcagcgagccaaggcgctggtgccgaacagcgggccggac
aaaaacctgattgaagtgcagcttgaaagcggcgcctcgctcaagagcaagtccatcgtg
atctcgaccggcgcgcgctggcgcaacatcaacgtgcccggcgagcatgagttcaagaac
aaaggcgtggcctactgcccgcactgcgacggcccgctcttcaagggcaaacgcgtggcg
gtgatcggcggcggcaactccggcgttgaagcggcaattgacctggccggcatcgtcggc
catgtgacgctgatcgaatatgacaccgcgctgcgtgccgacgccgtgctgcagcgcaag
ctgaacagcctggaaaacgtgacggtgttcaccaacgcgcagaccaccgaaatcaccggc
gaccagaaggtcaacggcctggtctacaaggaccgcgccagcggtgagcttaagacggtt
gagctggaaggcgtgttcatccagatcggcctggtgcccaacaccgattggctaaagggc
gtggtggagctgtccaaacacggcgagatcatcgtcgacgccaaaggccagacctcggtg
ccgggcgtgtttgctgccggcgacgcaacgaccgtgcccttcaagcagatcatcatcgcg
gccggtgaaggcgcgaaggcggcgctcagcgcgtttgactacctgatccgcagcccgatc
gccgcgcagtga

DBGET integrated database retrieval system