KEGG   Polaromonas sp. SP1: DT070_15165Help
Entry
DT070_15165       CDS       T05689                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00550  Peptidoglycan biosynthesis
pos01100  Metabolic pathways
pos01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DT070_15165
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DT070_15165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pos01003]
    DT070_15165
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pos01011]
    DT070_15165
Enzymes [BR:pos01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     DT070_15165
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DT070_15165
Glycosyltransferases [BR:pos01003]
 Polysaccharide
  Bacterial polysaccharide
   DT070_15165
Peptidoglycan biosynthesis and degradation proteins [BR:pos01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   DT070_15165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AYQ29245
UniProt: A0A3G3GCY0
LinkDB All DBs
Position
3186882..3189449
Genome map
AA seq 855 aa AA seqDB search
MNKLQTLLTQAREFAATIPGRLRHPTRRGVLLGLAAIPALMVLYVLLLIPFTPSISDLQK
AKTAKPSVVMSSDGQELASFKRANREWVKLEDISPNVIAALIATEDHRFYDHHGMDIKRT
VSSVFKTVTGKKQGGSTITQQLARNLYPEDIGRAATLTRKLKEAITAFKIEAVYTKDEIL
ESYLNTVPFLYNAYGIEMAARTYFDKSAEELDVLQSATLVGMLKGASYYNPVTSPDRALQ
RRNIVLAQMVKHEKLPQDKFAVLKKQPLKIDFERQEAELGAAPHLSQQLRRWLIEWADRN
DYNIYADGLVVRTTVDSRLQAMANAAVTRQGDRLQKIATSAWGGRNVWQAKSGSNKELVQ
TWVRDTAEYRAARTAGKTDEEVLKALQADSGFMDTLRDEKTRIQAGFLALNPSNGHVLAW
VGSRNFADDQFDHVAQARRQPGSTFKPFVYAAAFEAGAKPYEGFMDGPVEIPLGNGAFWR
PTDGGGPSNEMMTLRQGLMYSKNTITAQVMQVVGPAHVAKLAKSMGVRQSKLEEVPSLAL
GTSPVTLKEMVSAYGTIANDGRYIEPILITRVEDRNGKVLEEFQPKLAETAMTASVAETL
LDVMRGVIDQGTGAGIRSRFGIRADVAGKTGTTQDNTDGWFILMHPQLVAGAWAGFNDNR
VTMGNSWGPGAQSALPMVGEFFQQAIKAKVIDPQVRFPVPEGSSVIDPTIAQGAPAEAQP
PVEPPAENPAAVANSGGIGPAWGNSVPANPEPRVWQPAPVIKYVTINVPGNAPVNPPVNA
PAADSAPSMPVVQGAVAGAGQGGGQGQGSPISQPGMVLSPVETRRPQRVDVSPDTPQENF
PVFPGVVVGAPIAPR
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagctccagactctcctgacccaagcccgcgaatttgcggcgaccatacccggc
cgcctgcgccacccgacccggcgcggcgttttgctggggctggcggccatcccggcgctg
atggtgttgtatgtgctgctgctgattcctttcacgcccagcatttcagacctgcaaaaa
gccaagacggccaagccttctgtcgtgatgtcgtctgacgggcaggagctggcgtctttc
aagcgggccaaccgcgaatgggtcaagctcgaagacatctcgcccaatgtgatcgccgcg
ctcatcgcgaccgaagaccaccgcttttacgaccaccacggcatggacatcaagcgcacc
gtgtcgtcggtgtttaaaacagtcacgggcaaaaagcagggcggctccaccatcacgcag
cagctggcgcgcaacctctaccctgaagacatcggccgtgcggccacgctcacacgcaag
ctcaaagaggccatcacggccttcaagatcgaggcggtctataccaaggacgaaatcctg
gaaagctacctcaacaccgtgccttttttgtacaacgcctacggcatcgagatggcggcg
cgcacctacttcgacaaatcggctgaagagctggacgtgctgcaaagcgccacgctggta
ggcatgctcaagggcgccagctactacaaccccgtgaccagccccgaccgcgcgctgcag
cgccgcaacatcgtgctggcgcaaatggtcaaacacgagaagctgccgcaagacaagttt
gcggtgctgaaaaagcagccgctcaagatcgactttgagcggcaagaggccgagctgggc
gcggccccgcacctgtcgcagcagctgcgccgctggctgatcgaatgggccgaccgcaac
gactacaacatttatgccgacggcctggtggtgcgcaccacggtggattcgcgcctgcag
gccatggccaatgcggccgtcacgcgccagggcgacaggctgcaaaagatcgccacctcg
gcgtggggcgggcgcaatgtctggcaagccaagtcgggctcgaataaagaactggtgcag
acctgggtgcgcgacaccgcggaataccgggccgcgcgcacggcgggtaaaacggacgaa
gaggtgctcaaggccttgcaggccgacagcggctttatggacacgctgcgcgacgagaag
acgcgcatacaagccggcttcctggcgctgaacccatctaacggccatgtcctggcgtgg
gtgggcagccgtaattttgcggacgaccagtttgaccacgtggcgcaggcgcgccgccag
ccgggctcgaccttcaaaccctttgtgtatgccgctgcatttgaagccggcgccaaaccg
tatgaaggttttatggacggcccggtagagattcctttgggcaacggcgccttctggcgg
cccaccgacggcggcggccccagcaacgagatgatgacgctgcgccagggtttgatgtat
tccaagaacaccatcaccgcgcaggtgatgcaggtggtcggcccggcacatgtggccaaa
ctggccaagtccatgggcgtgcggcaaagcaaactggaggaagtgccttcacttgcgctg
ggcaccagcccggtcacgctgaaagaaatggtctcggcctacggcacgattgccaatgac
ggccgctatatcgagcccatcctcattacccgggtggaagaccgcaacggcaaggtgctt
gaagagttccagcccaagctggccgaaaccgccatgaccgcctcggtggccgagacgctg
ctggacgtgatgcgcggcgtgatcgaccagggcacgggcgccggtattcgcagccgcttc
ggcatacgcgccgacgtggcgggcaagaccggcaccacacaagacaacaccgacggctgg
ttcatcctgatgcacccgcaactggtggcgggggcgtgggcgggctttaacgacaaccgg
gtcaccatgggcaactcctgggggccgggcgcgcaaagtgcgttgcccatggtgggtgag
tttttccagcaggccatcaaggccaaggtgattgacccgcaggtgcgctttccggtgccc
gagggctccagcgtgattgacccgaccatcgcgcagggtgcgcctgccgaggcgcagccg
ccggttgaaccgccggccgaaaacccggccgccgtggcgaactccggcgggattgggccc
gcatggggcaattcagtgcccgccaacccggagccgcgcgtgtggcagcctgcgccggtg
atcaagtacgtgacgatcaatgtgccggggaatgcgcccgtgaatccgcctgtgaatgca
cctgccgccgacagtgcgccgtcaatgccggttgtgcagggggccgtggcgggggcgggg
cagggcggtggtcagggccagggctcacccatcagccagcccggcatggtcctttcccca
gttgaaacgcgcaggccgcagcgcgtggatgtttcgcctgatacgccgcaggaaaacttt
ccggtgttcccgggtgtggtggtgggcgcgccgattgcgccgcgctga

DBGET integrated database retrieval system