KEGG   Porphyrobacter sp. YT40: E2E27_00945Help
Entry
E2E27_00945       CDS       T06153                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pot  Porphyrobacter sp. YT40
Brite
KEGG Orthology (KO) [BR:pot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2E27_00945 (ahpF)
Enzymes [BR:pot01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E2E27_00945 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored K_oxygenase HI0933_like FAD_binding_3 Thi4 NAD_binding_8 DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: QDH33024
UniProt: A0A4Y6VWV0
LinkDB All DBs
Position
193308..194897
Genome map
AA seq 529 aa AA seqDB search
MLDAAMQAQLKTYLANLREGVELVASLDDSEKSRQTRTLIEQIAAQHNLVTARFDGTDDR
KPSFVIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQIRALEGDYN
FEMFFSLSCHNCPDVVQALTLMALENPRITATLIEGGTFQEEVERRDIMAVPATFLNGDP
FYNGKMELAEILAKLDVNADAKAAEKLAAKAPFEVLVVGGGPAGAAAAVYTARKGFRTGI
AAERFGGQLMDTLGIENLPGTPYTEGPKLTDSLKKHVGEYEIDLMDLARAVELRAAKDVG
GYHEVVMANGASLKARSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAGIVGHVTLIEFDVKLRADEVLQRKLRSMPNVEIITNGQTTEVLGD
GTRVNGLVVKNRANGEERRIDLEGVFVQIGLVPNTEWLRETGLELSKFGEIVIDDHGATS
IPGIYAAGDCTTVPHKQIVVAMGEGAKAGLGAFDFLIRNEPVEEIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgccgccatgcaggcccagctcaagacctatctcgccaaccttcgcgaaggc
gtggaactcgtcgcctcgctcgacgacagcgagaagtcgcgccagacccgcacactgatc
gaacagatcgccgcgcagcacaacctcgtcaccgcgcgtttcgacgggaccgatgatcgc
aagcccagcttcgtcatccgccgcgcttcggacgccgagaagtgggtgcgctttgcaggt
ctcccgatgggccatgaattcacgtcgctggtgctcgcgctgctgtgggccgggggccac
ccgcccaaggtcgatgcagatctgatcgagcagatccgcgcgctggaaggcgactacaat
ttcgagatgttcttctcgctctcgtgccacaattgccccgacgtggtgcaggcgctgacg
ctgatggcgctggaaaacccgcgcatcaccgcgaccttgatcgagggcggcaccttccag
gaggaggtcgagcgccgcgatatcatggcggtccctgcgaccttccttaacggcgacccc
ttctacaacggcaagatggagctggccgagattctggcgaagctcgacgtcaacgctgat
gccaaggcggccgaaaagctcgccgccaaggcgccgttcgaggtgctggtggtcggcggt
ggcccggcgggcgcggcggcggcggtctataccgcgcgcaagggcttccgcaccgggatc
gcggcagagcgcttcggcggacagttgatggatacgctcgggatcgagaacctccccggc
acgccctacaccgagggcccgaagctgaccgacagcctcaagaagcacgtcggcgaatac
gagatcgacctgatggacctcgctcgcgcagtcgaactgcgcgcggcgaaggacgtgggc
ggctatcatgaagtcgtgatggccaacggcgcgagcctcaaggcgcgctcgttgatcctc
tccaccggcgcgcgctggcgcaacctcggcgtccccggcgaggcggaataccgcaacaag
ggcgtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcatcgcggtg
atcggcggcggcaactccggcgtcgaagcggcgatcgacctcgccgggatcgtcggccac
gtcacgctgatcgaattcgacgtgaagctacgcgccgacgaagtgttgcagcgcaagctg
cgctcgatgccgaatgtcgagatcatcaccaacggccagaccaccgaagtgctgggtgac
ggcacccgcgtgaacggcctcgtggtcaagaaccgcgccaatggcgaagaacgccgcatc
gatctggaaggcgtattcgtccagatcggcctcgtgcccaacaccgagtggctgcgcgag
acggggctggagctgtcgaagttcggcgagatcgtgatcgacgatcacggcgcgaccagc
atccccggcatctacgccgcgggcgactgcaccaccgtgccgcacaagcagatcgtcgtc
gcgatgggcgaaggcgcgaaggcgggcctcggcgcgttcgacttcctcattcgcaacgag
ccggtcgaggaaatcgcgcaggctgcttga

DBGET integrated database retrieval system