KEGG   Porphyrobacter sp. YT40: E2E27_01630Help
Entry
E2E27_01630       CDS       T06153                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
pot  Porphyrobacter sp. YT40
Brite
KEGG Orthology (KO) [BR:pot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2E27_01630
Enzymes [BR:pot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     E2E27_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: QDH36013
UniProt: A0A4Y6W6C5
LinkDB All DBs
Position
complement(345626..347758)
Genome map
AA seq 710 aa AA seqDB search
MLANCSQIFGSGESAEGITAAMLVSADGDSANWISHGRTYSEQRYSPLDQVNTDTVGQLG
LDWYADMDTARGQEATPLVMDGKLYLTTAWSKVKAFDAATGKPLWEYDPKVPGETAVKAC
CDVVNRGLAAWGDKLFFGTLDGRLVALDRESGTPAWETVTVDQSKSYTITGAPRVIDGKV
IIGNGGAEFGVRGFVAAYDAESGKQLWKFYTVPEGGQGAGARDDAPAYLQKAAETWNMDV
LGANDAIGGGGTVWDSMAYDPDLDLLYIGVGNGSPWNRAYRSPGKDGTGEGDNLYLSSIV
AIRPKTGEYVWHYQTTPGETWDFTATQHIMLADMEIDGKPRKVLMQAPKNGFFYVIDRAT
GEFISAKPYVGLNWASGIDPETGRPIENPETRIDRTGQPALVLPGPLGGHNWHPMAYNPR
ENLVYIPAFEAGMLYAPEADWKPDRARGFNVGFSFAGELPADGGFRKEAAGTLKGRLVAW
DPVAQKARWTVEHEGPWNGGLLSTGGGLVFQGTAGSEFNAYDAATGNKLWSFAAQTGVVA
PPVTYTVNGEQYVAVLAGWGGAYALSVDGDLIARKAPVRNISRLLVFKLGGTAKLPPVPA
LADLPLDPPPSTASPETIALGQAKYGRYCAVCHAPGATGSTVLPDLRRAGSLESASAWNA
VVEGGILKDNGMASFKTSLSKDEIEAIRAYVIKRANEDKAIEAGTKVARR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaattgcagccagattttcgggagcggcgaaagcgcagagggcattaccgcc
gcgatgctggtgagcgcggacggggattcggccaactggatcagccacgggcgcacctat
tccgaacagcgctactccccgctcgatcaggtcaataccgataccgtcggccagctgggc
ctcgactggtatgccgacatggacaccgcgcgcgggcaggaagcgacgccgctggtgatg
gacggcaagctctacctcaccaccgcgtggagcaaggtgaaggccttcgacgccgccacc
ggcaagcccttgtgggaatatgatcccaaggtaccgggcgagacggcggtcaaggcctgc
tgcgacgtggtgaaccggggccttgcggcgtggggcgacaagctgttcttcggcacgctc
gacgggcggctggtcgcgctcgaccgcgagagcggcacccccgcgtgggagacggtcacg
gtcgatcagtccaagagctacacgatcaccggcgcgccgcgtgtgatcgatggcaaggtg
atcatcggcaatggcggcgcggagttcggcgtgcgcggctttgtggccgcctatgatgcg
gagagcggcaagcagctgtggaagttctacaccgtgcccgaaggtggccaaggagcaggg
gcgcgcgatgatgccccggcctatctgcaaaaggccgccgaaacctggaacatggacgtg
ctgggggccaacgacgcgatcggcggcggcgggacggtgtgggattcgatggcctacgat
cccgatctcgatctgctctatatcggggtcggcaacggcagcccgtggaaccgcgcctat
cgctcgccgggcaaggacgggacgggggagggcgacaacctctacctctccagcatcgtc
gcgatccggcccaagaccggcgaatatgtgtggcactaccaaaccacgccgggcgaaacg
tgggacttcaccgccacgcagcacatcatgctcgccgacatggagatcgacgggaaaccg
cgcaaggtgctgatgcaggcgcccaagaacgggttcttctacgtcatcgaccgcgcaacg
ggcgagttcatcagcgccaagccctatgtcgggctcaactgggcctccggcatcgatccc
gagacgggccgcccgatcgagaatcccgagacccggatcgaccgaaccggccagcccgcg
ctggtgctgcccggcccgctgggcgggcacaactggcacccgatggcctacaacccgcgc
gagaacctcgtctatatcccggccttcgaggcggggatgctctacgcgcccgaggccgac
tggaagcccgaccgcgcgcgcggcttcaatgtcggcttcagctttgccggcgagcttccg
gcggatggcggcttccgcaaggaggcggcgggcacgctcaaggggcgcttggtggcatgg
gacccggtagcgcagaaggcgcgctggacggtcgagcacgagggcccctggaacggcggc
ctgctctcgaccggcgggggactggtgtttcaaggcaccgcggggagcgaattcaacgcc
tatgatgcggccaccggcaacaagctgtggagcttcgccgcgcagaccggcgtagtcgcg
ccgcccgtcacctacacggtgaacggcgagcaatatgtcgccgtgctggccgggtggggc
ggggcctatgcgctgtcggtcgatggcgatctgatcgcgcgcaaggcgccggtgcgcaac
atctcgcggctgctggtattcaagctcggcggcaccgccaagctgccgccggtgcccgcg
ctcgccgacctcccgctcgacccgccgccgagcaccgcctcgcccgagacgatcgcgctg
gggcaggccaaatacggccgctattgcgcggtatgccacgcgcccggagcgaccggatcg
accgtgctgcccgatctgcgccgcgccggttcgctcgaaagtgcaagcgcatggaacgcg
gtggtcgagggcggcatcctcaaggacaacggcatggcgagcttcaagacctcgctcagc
aaggacgagatcgaagcgatccgcgcctatgtcatcaagcgcgcgaatgaggacaaggcg
atcgaggcgggcacgaaggtcgcgcggcgctaa

DBGET integrated database retrieval system