KEGG   Porphyrobacter sp. YT40: E2E27_12070Help
Entry
E2E27_12070       CDS       T06153                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
pot  Porphyrobacter sp. YT40
Brite
KEGG Orthology (KO) [BR:pot00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    E2E27_12070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: QDH34996
UniProt: A0A4Y6VXD9
LinkDB All DBs
Position
2586659..2587441
Genome map
AA seq 260 aa AA seqDB search
MTLEPLQYLLGALSGSLVGFTLGLVGGGGSILAVPLMVYLVRVPNAHLAIGTSAFAVAAN
AATGLIGHAKAHNVKWRCGGMYATAGVIGALFGSTAGKAVDGGKLLFLFALVMVVVGVLM
LRGRGDTGSPGAECNREKAPKVLGYGLGTGLFSGFFGIGGGFLIVPGLIGSTGMPILNAV
GTSLIAVTAFGLTTAANYAFSGLVDWPLAFVFIAGGVVGGLIGTRIAKRLGSGGTLTTVF
AVLIFVVATYMLWKSAAAFL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgaaccgctccagtatctgttgggcgcgctgtccggcagcctggtgggcttt
accctcgggcttgtcggcgggggcggctcgatcctcgccgtgccgctcatggtctatctg
gtgcgcgtgcccaacgcccacctcgccatcggcacgagcgcgttcgcggtggccgctaac
gctgcaaccggcctgatcggtcatgccaaggcgcataacgtcaaatggcgctgtggcggc
atgtatgcgaccgccggcgtcatcggcgccctgttcggctccaccgcgggcaaggccgtc
gatggcggcaagctcctgttcctgttcgcgctggtcatggtcgtcgtcggcgtcctgatg
ctgcgcgggcgcggtgacacgggcagcccgggggcggagtgcaaccgggaaaaggcgccg
aaggtgctgggctacggccttggcaccggtctgttctcgggcttcttcggcatcggcggg
ggctttctgatcgtccccggcctgatcgggtcgacgggcatgccgattttgaacgctgtc
ggcacgtccttgatcgccgtcaccgcgttcgggctgacgacggccgccaactacgcgttt
tccggtctggtagactggccgctcgctttcgtgttcatcgccggtggggttgtcggcggc
ctgatcggcacgcgcatcgcgaagcgcctcggctcgggcggcacgctcaccacggtcttc
gccgtcctgatcttcgtggtggcgacctacatgctctggaaaagcgcggccgcgtttctt
tga

DBGET integrated database retrieval system