KEGG   Paralichthys olivaceus (Japanese flounder): 109623949
Entry
109623949         CDS       T06037                                 

Gene name
cd82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109623949 (cd82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109623949 (cd82)
   04090 CD molecules [BR:pov04090]
    109623949 (cd82)
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109623949 (cd82)
  Exosomal proteins of other body fluids (saliva and urine)
   109623949 (cd82)
  Exosomal proteins of colorectal cancer cells
   109623949 (cd82)
CD molecules [BR:pov04090]
 Proteins
  109623949 (cd82)
SSDB
Motif
Pfam: Tetraspanin DUF1310
Other DBs
NCBI-GeneID: 109623949
NCBI-ProteinID: XP_019933967
LinkDB
Position
Unknown
AA seq 256 aa
MGKGCITVTKYFLFLFNLLFFIFGALIMGFGLWVLFDNQSFIAVLQESSHTVKVASYILI
GVGSLSMAMGFFGCIGAIYEIRCLLGLYFTCLLLILIAQVTAGVLIYFQREPLKYEMANI
IKGMMINYTGENRTTEHTWDFIQRTMKCCGWTGPGNWSENLLIMNNSKNLYPCSCRNGDL
PGTDIEEVGMCEHTSKQLPVYETGCIVSVEKWLLDNCGVILGMCVGVAVVELLGMILSMC
LCKSVVQEDYTKVPKY
NT seq 771 nt   +upstreamnt  +downstreamnt
atggggaaaggatgcatcacagtcaccaagtattttctgttcctcttcaacctcctcttc
tttatcttcggagccttgatcatgggctttggactctgggttctctttgataatcagagc
ttcattgctgtgctgcaggaatcatcgcatacagtgaaagtggcttcatacatactgatc
ggagtgggttcactgtcgatggccatgggcttcttcggttgcatcggagccatctacgaa
atccgttgtctgctgggtctgtacttcacctgcctcctgctcatcctcatcgcccaggtc
acagctggagtcctcatttacttccagagagagccgttgaaatatgagatggccaacatc
ataaagggcatgatgatcaactacaccggcgagaacaggaccacagagcacacatgggac
ttcattcagaggacgatgaagtgctgtggatggactggtccaggaaactggtctgagaac
cttttgatcatgaacaactctaagaacctttacccatgttcctgtcgtaacggggatctg
cctggcacggacatagaggaagtcggcatgtgtgagcacacgtccaaacagctacctgtc
tacgaaacgggctgtatcgtcagcgtggagaaatggctcctggacaactgcggcgttatt
ctgggaatgtgtgtcggcgtggcagtcgtggagctcctcgggatgattctctccatgtgt
ctgtgcaagagcgtcgtccaggaagattacaccaaagtaccaaagtactga

KEGG   Paralichthys olivaceus (Japanese flounder): 109645433
Entry
109645433         CDS       T06037                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109645433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109645433
   04090 CD molecules [BR:pov04090]
    109645433
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109645433
  Exosomal proteins of other body fluids (saliva and urine)
   109645433
  Exosomal proteins of colorectal cancer cells
   109645433
CD molecules [BR:pov04090]
 Proteins
  109645433
SSDB
Motif
Pfam: Tetraspanin DUF4229
Other DBs
NCBI-GeneID: 109645433
NCBI-ProteinID: XP_019966601
LinkDB
Position
Unknown
AA seq 237 aa
CFQLFGVVIMGFGLWLLLDNQSFIVVLNNSTAVKVACYILIGVGAFSMLMGFLGCLGAIY
EIRCLLGLYFTCLLLILLAQITAGALIYFQKDGLNEEMSKIVSRVLDNYPGTNSSTEQAW
DFIQRNMECCGWSSHLDWNGNMVIVNSSQLLFPCSCQNISLVAGNFSDSGFCEAQTPDWP
VYDVGCSASVESWLLTNIGVVLGICLGVALIELLGMILSMCLCRSVHKEDYTKVPKY
NT seq 714 nt   +upstreamnt  +downstreamnt
tgtttccagttgttcggggtcgtcatcatgggcttcggactgtggctacttctggacaat
cagagcttcatcgtcgtcctcaataactccacagctgttaaagtggcctgttacatcctg
atcggagtcggagcgttctccatgctcatgggattcctcggctgcttgggggccatttat
gagatccgctgtctgctcggcctgtacttcacctgcctcctgctgatccttctggctcag
atcaccgccggcgctctcatctacttccagaaggacgggttaaacgaggaaatgtccaag
atcgtctccagggtgctggacaactaccccggaaccaactccagcacagagcaggcgtgg
gacttcatccagaggaacatggagtgctgtggctggagctctcatctcgactggaatgga
aacatggtgatcgtcaacagctcccagctgctgttcccctgctcctgccagaacatctcg
ctcgtagcaggaaacttctccgacagcggattctgtgaggctcagacgcccgactggccc
gtatacgacgtgggctgttctgccagtgtggagagctggctcctcaccaacatcggcgta
gtgctgggtatctgcctgggggtggcgctcatcgagctgctggggatgatcttgtccatg
tgcctgtgcaggagcgttcacaaggaggattacaccaaagtgccaaagtactga

DBGET integrated database retrieval system