KEGG   Paralichthys olivaceus (Japanese flounder): 109623964
Entry
109623964         CDS       T06037                                 

Gene name
pidd1
Definition
(RefSeq) p53-induced death domain-containing protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109623964 (pidd1)
   04115 p53 signaling pathway
    109623964 (pidd1)
SSDB
Motif
Pfam: LRR_8 Peptidase_S68 ZU5 LRR_4 Death Importin_rep_2
Other DBs
NCBI-GeneID: 109623964
NCBI-ProteinID: XP_019933990
LinkDB
Position
Unknown
AA seq 1003 aa
MVAPTLRGQTHHVERKHVGQQVTVNNSSEEGAAADEEDGDSLDEVTSSQGGVPGSPRKFW
LGGVMSEGQEELLEPEREESPAAPSASPISLMDTCAPSISSLSSASCSSVHHHTDFSNSS
SSSSVLSLTPPLPPSVELSAVLTDTRLTLDVYQGGAAALPLLWASVPGQLRGLQYLGLGS
EDKPALDGALDVLPHLTELQSLVVRGHRFYDSRGDPLPGLLTTLPSSVSALSRLVRLDLS
FNQISCLPSSLLSIPTLSSMILCHNHLSALPPDIGVLSSLTYLSLLGNELVSLPPSLGRL
KALQVLDVSHNLLQHLPDEIGSLEKLVKLELSHNKLKELPETLGSLLSLRELFISSNDLR
LIPHCLNKLPMLKIDVRDNPLGRPLTPPPLSPTPNQAETKIPELHLGSNQHSFCISSAGC
HVFLPGGAELLFPPGCLVTTTRLEWVEKRPQKKWVWLEEHDILLSRPLELRPHGITFLKP
VQVCVPYHRAKRKEVVVRRFDGQSWSTLPTDLRRGSEGHSSHPGGRLARLACCSVSQFSW
FMAVSRLVKDTCSVTPTGALLVSSSDPGIKLHFPPDCTAQTRTITLQVLQVSVSEVQMLC
GDPQARVSPLLCLSQTPNMHFLQPIKVQIPLPPGVTGHTVDETRLHVLHGDPTAQTWTDI
TSQVSLCFTHLYAVFYITHFSWYWLWYTTQRYVCGVARKVYQRLKQFKVQFFVLQRKHDP
SQVLLQCLPANKVEGRVQSLSEQYDGPQPSDLCDLLEGEQFFAGFERGLDISTDRPDCVQ
GRLCFVFYSSLKNLKEVYICPAQGQKGPVRGQVSFYRGDIPNHLPEEVARKRKGDDSQWL
ATLPLRLPALNSDNSYIMEEKQYPPLNLGDPESGYLTEANLLSISLQIGHDWRVIGINLG
LSYQELDHIQYKHRDNLGALVLNMLFHWARKAGPGAVSKLVDAMIESGRRDLADEIEDIV
SIGRRKYSQSLRRLGLEADSSPLEESTAVDEAALATDGCRTLE
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggtagcaccgacactgcggggacagacccaccatgtggagagaaaacacgtgggccag
caggtgactgtcaataactccagtgaggaaggagcagctgctgatgaagaggatggagac
agtttggatgaagtgacatcatcccaaggtggagtaccagggtcccctcggaaattttgg
ctcggaggtgtcatgtctgagggacaagaagagctgctggagccagagagggaggagagc
ccagcggctccctctgcctctcccatcagcctcatggacacctgtgctccttccatttca
agtctctcctccgcctcctgcagctccgtccatcatcacacagatttttctaattcttca
tcatcttcctctgtcctgtctcttaccccacccctgcctccctctgtggagctctctgct
gtgttgactgacacaaggctgaccctggatgtgtaccaggggggagcagccgcactaccc
ctgctgtgggcgtccgtccccgggcagctgagggggctccagtacctgggactgggctct
gaagacaaaccagcgctggatggagcactggatgtccttcctcatctgacagaactgcag
tccctggttgttcggggacaccgtttttatgactcgcgaggtgacccgctccctggcctc
ctcactactttgccctcatctgtttctgccctctcgcgtctggtgcgcctggatctctcc
ttcaaccagatctcctgtctgccgtcctccctgctcagcattcccacgctgtcctccatg
atcctctgccacaaccacctctcagctctgcctcctgacataggcgtactgtcctccctc
acctacctctccctcctggggaacgagctggtctcccttcctccgagtctgggtcgactg
aaagctctgcaggtgctggacgtatcgcacaatctcctccagcacctacctgatgaaata
ggttctctggagaagcttgttaagctggaattgtcccacaacaaactgaaagagctacca
gagaccttgggctctctcctttcgctcagggagcttttcatctccagcaatgacctccgc
ctgatcccacattgtctgaacaaactgcctatgctgaaaatagatgtgcgtgacaatccg
ctgggacgaccgctaacccctccacctctgtctcctacacccaatcaagctgaaacaaaa
atcccagagttgcacctcggatctaatcagcacagtttctgtatttcgtctgctggctgt
catgtgtttctgcccgggggggccgagctgctgttccctccggggtgcctagtgacaacc
acaagactggagtgggttgagaaaaggccacagaagaagtgggtgtggttggaggagcat
gacatcctgctgagtcgccctctggaactgcgtccccatgggattacttttctcaagcct
gtgcaggtgtgtgtgccatatcatcgggcaaaaagaaaggaggtggtcgtgcggaggttt
gatggacagtcgtggagcaccctgcccactgatctgaggagggggagcgagggccatagc
agtcaccctggaggacgtcttgccagactggcgtgctgctcagtgagccagttctcctgg
tttatggccgtgtcccgtctagtgaaggacacttgctctgttacaccaactggagcgctg
ctggtttccagctctgaccctggaatcaagctccatttccctccagactgcaccgcgcag
acccgtaccataacactacaggtgttgcaggtgtctgtgtcagaggtacagatgctttgt
ggcgaccctcaggccagagtcagccctctcctctgcctctcccagactcccaacatgcat
ttcctgcagccaatcaaagttcagatccctttgccacctggagtcacaggccatacagtt
gatgagacccgtttgcatgtgctccacggggaccccactgcccaaacctggactgacatc
acatcacaagtgtctctctgcttcactcatttgtatgcagttttctacattacacatttc
tcctggtactggctgtggtacaccactcagcgatatgtttgtggtgtggcaaggaaggtc
tatcaaagactgaaacagtttaaagtccagttcttcgtcctccagcggaagcacgacccc
tcacaagttttgctacagtgtttacctgctaacaaggtggaaggcagagttcagtcgttg
tctgagcagtatgatggacctcagccgtcagacctgtgtgacctacttgaaggagagcag
ttcttcgccggctttgagaggggattggatatcagcacagacagaccagactgtgtgcaa
ggaagactgtgttttgtgttttactccagcctgaagaatctgaaggaagtgtacatctgt
ccagctcagggtcagaaggggccagtgaggggacaagtatctttttatagaggggacatt
cccaaccatctaccagaggaagtggcgagaaagagaaaaggagacgacagccagtggctt
gcaactttgccgctaaggcttcctgctttaaactccgacaacagttacatcatggaggag
aaacaatatcctcctctgaacctgggtgaccccgagagcggctatctgacagaggccaat
ctgctgtccatttcccttcagataggacacgactggcgtgttattggcatcaatcttggc
ctaagctaccaggagttggaccacatccagtataaacacagggacaacctgggagcactg
gtgctgaacatgctgttccactgggcaaggaaggcaggtccaggggctgtgtccaagctg
gtggatgctatgatagagagcggcaggagagacctcgcggatgagattgaggacattgtc
agcataggaaggagaaagtactcacagtcactgaggagattgggcctggaagcagacagc
tccccccttgaagaaagcacagcagtagatgaggcagcgctcgctacagatggctgtcgt
acacttgagtaa

DBGET integrated database retrieval system