KEGG   Paralichthys olivaceus (Japanese flounder): 109623974
Entry
109623974         CDS       T06037                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04340  Hedgehog signaling pathway
pov04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109623974
   04340 Hedgehog signaling pathway
    109623974
   04068 FoxO signaling pathway
    109623974
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109623974
   04115 p53 signaling pathway
    109623974
   04218 Cellular senescence
    109623974
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109623974
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin
Other DBs
NCBI-GeneID: 109623974
NCBI-ProteinID: XP_019934007
LinkDB
Position
Unknown
AA seq 297 aa
MELLCLEMDTVIRARPDPNLLCDDRVLQSLLTIEERFLPQYSYFKGVQKDIQPFMRRMLA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTKKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRRLPLPEDKLALIRKH
VQTFIALCATDFRFAMYPPSMIATGSVGAAICGLQLDSTDQSQWGDSLTDLLAKITNTEV
DVLKECQEQIERVLVSSLRDGRQQQQQQQQTQRGPSGKGLDELDQSSTPTDVRDVNL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagctgctctgcctcgaaatggacaccgtcatacgagctcgtcccgatcccaacctc
ctgtgcgatgacagggtcttgcagagcttgttgaccatcgaggagaggtttctaccccaa
tattcctatttcaaaggcgtccagaaagacatccagccgttcatgaggaggatgttggct
acttggatgttggaggtctgtgaggagcagaagtgcgaagaagaagtttttcccttggcc
atgaactacttggacagatttttagccgtggtacccaccaaaaagtgcaacctgcagctg
ctgggtgcagtctgcatgttcctcgcatccaaattgaaagagactcgtccactaactgca
gagaagctttgcatctacacagataactccatcagacctcaagagctgctggaatgggaa
ctggtggtgttggggaagttgaagtggaacttggcagcggtgacgccgaacgacttcatt
gagcacattgtgaggaggctgccgctgcctgaggataaactggcacttatacgcaaacat
gtccagaccttcatcgccctctgtgccacagatttcagattcgccatgtaccccccctcc
atgattgctacaggaagtgtgggggcagcgatctgtggcctgcagctggattcaactgac
cagtcacagtggggcgacagcctgacagacctgctggctaaaatcacaaacacagaagtg
gatgttctgaaagagtgtcaggagcagattgagcgcgtgctggtgagcagcctgcgtgac
gggcggcagcagcagcagcagcagcagcagacacagaggggccccagcggcaaaggtctg
gatgagctggatcaatcctccaccccaacggacgtccgtgatgtcaacttgtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109625110
Entry
109625110         CDS       T06037                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04340  Hedgehog signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109625110 (ccnd1)
   04340 Hedgehog signaling pathway
    109625110 (ccnd1)
   04371 Apelin signaling pathway
    109625110 (ccnd1)
   04068 FoxO signaling pathway
    109625110 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109625110 (ccnd1)
   04115 p53 signaling pathway
    109625110 (ccnd1)
   04218 Cellular senescence
    109625110 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109625110 (ccnd1)
   04530 Tight junction
    109625110 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109625110
NCBI-ProteinID: XP_019935765
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEETYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIQPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSSTTETKHMDDDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctactgtgctgcgaggtggactccatcaggagagcctaccaggacgtt
aacctgctcaacgaccgggttctccacacaatgctgaaggcagaggaaacctacctaccg
tctcccaactacttcaagtgtgttcagaaagaaatcattcctaaaatgcggaaaatagtt
gccacatggatgttagaggtctgcgaagaacagaaatgcgaggaggaagttttccccctt
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaactcgactacag
ctgctgggagccacatgcatgtttctagcatctaagatgaaggagacagttccgttaaca
gcagagaaactctgtatctacacagacaactcaattcagcctggagaactactgcaaatg
gaactgctggttctcaacaagctgaagtgggatctggcttcagtcacacctcacgacttc
attgaacactttctgtccaagctgaagatctacccgtccaccaagcagatcctgaggaag
catgcccagacctttgtggcactctgtgctacagatgttaacttcattgccagtcctcca
tccatggtggcagcaggcagtgtggttgcagctgttcaaggtctctacctgaagagtcaa
gatgcctccttgtcctcccagaacctcaccaacttcctgtcgcaagtcattcgcagtgac
ccggactgcctgcgttcatgtcaggagcagatagagtctttgctagaatcaagcctgagg
caggctcagcaacacagcagcacaacagaaaccaaacacatggatgacgacgtggacctg
tcctgcaccccaacagacgtcagagacataaacatctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109629233
Entry
109629233         CDS       T06037                                 

Gene name
ccnd3
Definition
(RefSeq) G1/S-specific cyclin-D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109629233 (ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109629233 (ccnd3)
   04115 p53 signaling pathway
    109629233 (ccnd3)
   04218 Cellular senescence
    109629233 (ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109629233 (ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109629233
NCBI-ProteinID: XP_019942391
LinkDB
Position
Unknown
AA seq 279 aa
MDLQLQNGSSEVTGETDRVRMIRAHSDPAVTGDPRALRTLAALESPGHVPPDSDRVPTDV
KPKMRRTLVVWMLQVCEEQQCEQEVFPLATHYLDSYLNTCAIDKNHLQLLGTVCMSLASK
MRDTVPLTASMLCIYADNSITASDILHWEMEVVSRLDWCLASVVPSDFLEPILHALPFVR
PPHFPNVRRRFHSYVALAATGELHHRFSTFLPSTVACACVSVTMQSVKLEDAAVSSDWPM
KFLANLLAIDLNSLLLCYDQLWSVLELSLPFHSQDSVCR
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatctacagcttcaaaatggctcctcggaagtcaccggggaaacggaccgtgttagg
atgatccgggcgcacagcgaccccgcggtgaccggcgacccccgggcactgcgcaccctg
gcggccctggagagccccggccacgttccccccgactcagacagagtgccgacggacgta
aagccgaagatgaggaggactctggtggtgtggatgttacaggtgtgtgaggagcagcag
tgtgagcaggaggtgttcccgctggccacccactacctggactcgtacctgaacacatgc
gccatcgacaagaaccacctgcagcttttagggactgtctgcatgtctctggcctccaag
atgagagacaccgtccccctgactgccagcatgctctgcatctacgcagacaactcgata
acagcgtcagacatcctgcattgggagatggaggtggtgtccaggttggactggtgtctg
gcctccgtggttccctctgacttccttgagccgattctccatgctctcccctttgttcgg
cccccccacttcccaaacgtgcgcaggcgttttcactcctacgttgctctggccgccact
ggtgagttacaccacaggttctcaacattcttgccctccactgttgcctgtgcctgtgtg
agcgtcaccatgcagagcgtaaagttagaggacgctgccgtctcctctgattggcccatg
aagtttttggccaaccttttggccattgatctgaactcgctccttctctgctacgatcag
ctgtggagtgtgctggagctcagcctgcccttccactctcaggacagtgtttgcagatag

KEGG   Paralichthys olivaceus (Japanese flounder): 109632688
Entry
109632688         CDS       T06037                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04340  Hedgehog signaling pathway
pov04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109632688
   04340 Hedgehog signaling pathway
    109632688
   04068 FoxO signaling pathway
    109632688
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109632688
   04115 p53 signaling pathway
    109632688
   04218 Cellular senescence
    109632688
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109632688
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109632688
NCBI-ProteinID: XP_019947671
LinkDB
Position
Unknown
AA seq 436 aa
MAERDDDIILVSERRLVIGLLSSSNGTGQTEHTSGARQCKSDALGFSRVAGGASVQTESQ
EASERVCPSPGPCALRQGSYCEGLAGCVAPVRGRSDLRAAAEEEVNREAAGVERTRPSPL
HASSWALLLLLLLLLLPAVDHHPTLVRSVSRFSHRNKRDRGREQKRRRGKKGARVMELYC
LESDITVRAQPDPNILYDDRVLQSLLTIEDKFLPPCSYFQRVQKDIQPYMRRMVAGWMHE
VCEEEKSNEDVFPLAINYLDRFLAVMSTRKNYLQLLGAVCIFLASKLKDSRSLSAEKLCM
YTDNSITPRELLDWELVVLGKLKWNMASVIPNDFIEHIIRRLPLPKDKLAMVRKHTLTFI
ALCATDDRLAMNPPSMIATGSMGAAVCGLQLDRSDQRLTRDNLTDLLAKITNTEVVSTTV
TEIYTWQSSLSHSNSL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggcggagcgggacgatgacatcatattggtctcagagcggcggctggtaattggcctg
ctctcctcctccaacggcacgggccaaacagaacacacaagtggagccaggcaatgcaag
tcagatgcactgggtttttccagagtggctggtggggcctcagtgcagactgagagccaa
gaggcctctgagagggtctgcccatctccgggcccctgtgctctgagacaaggctcttat
tgtgaaggtctcgccggatgtgtcgctccggtgaggggccggtcggaccttcgagctgcc
gcagaggaagaagtgaaccgggaggcagcaggagtggagcgaacccggccatctcctctt
catgcttcgtcctgggcacttctcctcctcctcctcctgctcctgctgcccgctgtcgac
caccatccgacactagttcgctcggtttcacgttttagccacagaaacaaacgagacaga
gggagagagcagaagcggaggagggggaagaagggggcccgagtcatggagctgtattgc
ctggagtcggacataaccgtgagagcccagcctgacccaaacatcctgtacgatgaccga
gtgttgcagagtttattaaccattgaggacaagtttttacccccgtgctcgtacttccag
cgggtccagaaggatattcaaccctatatgagacgaatggttgcaggctggatgcacgag
gtgtgtgaagaggagaagagcaacgaagacgtcttccctttagccattaattatttggac
agatttttagcagtgatgtctactagaaagaactacttgcagctcctgggagccgtgtgc
attttcctggcctccaagttaaaagacagccggtcgctatcagcagaaaaactctgcatg
tacacagacaactccatcacaccacgggagctgctggactgggaacttgttgtgctgggg
aagttgaagtggaacatggcctcagtcattcccaatgattttatagaacacatcatacgc
aggctgccccttcccaaagacaagctggcgatggtgcgcaaacacacgctgacattcatc
gccctctgtgctacagatgaccgcctcgccatgaaccccccttccatgattgccacaggc
agcatgggagctgctgtatgtggcctccagttggaccgctctgaccagaggctgactcga
gacaacctgacagacctgctggccaagatcaccaacacagaggtggtgagtaccacagtg
acggagatttatacatggcagtcatctctctcacacagcaattcattgtaa

KEGG   Paralichthys olivaceus (Japanese flounder): 109642994
Entry
109642994         CDS       T06037                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04340  Hedgehog signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109642994
   04340 Hedgehog signaling pathway
    109642994
   04371 Apelin signaling pathway
    109642994
   04068 FoxO signaling pathway
    109642994
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109642994
   04115 p53 signaling pathway
    109642994
   04218 Cellular senescence
    109642994
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109642994
   04530 Tight junction
    109642994
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109642994
NCBI-ProteinID: XP_019963534
LinkDB
Position
Unknown
AA seq 304 aa
MTQSATDRVKDMESLLLCREADRPARAYRDSNLLTDRVLRALLRAQDKYLPASNYFKCVQ
REIVPYMRRIVAIWVLEVCEEQRCEEEVFPLAMNYIDRFLSVEPTKKNDLQLLGAACMFL
ASKLRKTIPLTAEKLCIYTDNSITPTQLMQMELLVLNKLKWDLASVTPLDFIDHFLSQLP
VSRESRTILRKHAQTFAKLCATDNKFIASPPSMVAAGSMVAAVEGLQIKMVGNALMAQKL
TEQLAQTIRSDSDCLRACQEQIELLLENSLRQAQQQNSVAVETKNIGERQDLSTTPTDVC
DINI
NT seq 915 nt   +upstreamnt  +downstreamnt
atgacacaaagcgccacagacagggtgaaagacatggagtctctgcttctgtgccgtgag
gcggacaggcctgccagggcttaccgggactccaacctgttgactgaccgggtcctgcgt
gcgctcctgcgagctcaagacaagtacctcccagcttccaactatttcaaatgcgtccag
agagaaatagttccgtacatgaggaggatagtggctatctgggtgttggaggtgtgtgag
gagcaaagatgtgaggaggaagttttcccactggctatgaactacatagaccgcttcctg
tcagtggaacccaccaagaagaacgatcttcagttattgggagctgcctgtatgttcctg
gcatccaaactgaggaagacaatcccactcactgctgagaaactctgcatctacacagac
aactctattacacctactcagctgatgcaaatggagttactggttttgaacaaactcaaa
tgggacctggcttcagtaaccccccttgacttcatcgaccacttcctgtcccagctgcct
gtcagtagagagagcaggaccatactcaggaagcacgctcagacctttgcaaagctgtgt
gccacagataataaattcatagccagccctccatccatggtagcagcaggcagcatggtg
gcagcagtggagggcttacagataaaaatggtgggaaatgccttgatggcacagaaactg
acagagcaacttgcacaaaccatcaggagtgactcagactgccttcgagcatgtcaggaa
caaattgagctgttgctggaaaacagtctcagacaggcacaacagcaaaactctgttgct
gtggaaactaagaacattggcgagaggcaggacctctcaactacccccacagatgtctgt
gacataaacatctga

DBGET integrated database retrieval system