KEGG   Paralichthys olivaceus (Japanese flounder): 109624175
Entry
109624175         CDS       T06037                                 

Gene name
ddb2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov03420  Nucleotide excision repair
pov04115  p53 signaling pathway
pov04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109624175 (ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    109624175 (ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109624175 (ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pov04121]
    109624175 (ddb2)
   03400 DNA repair and recombination proteins [BR:pov03400]
    109624175 (ddb2)
Ubiquitin system [BR:pov04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109624175 (ddb2)
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      109624175 (ddb2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 109624175
NCBI-ProteinID: XP_019934248
LinkDB
Position
Unknown
AA seq 491 aa
MKSRAADSEGSKSKGKGKKRPAEKSAPSLSRTRRDKKDGETSKAGPPPLKFAGVQRRGVH
GSILHYIYKNTLGQSLHSQMRQCLQEPFIRSLSSYHFHSATSPFDRRITCLEWNPVHHTT
LAVGSKGGDIHLWDYEVPTKKSFIQGNGAGDFIGGMKFCPTDSSRVYVASGEGNLSMHSF
EGLTPTTLSRTQDCGHDHHNVCYWYCCVDVSVSRQMLVTGDNMGQLLLLGLDGQKIFSNK
LHKAKVTHAEFNSRCDWLLATASVDHTVKLWDLRNIKDQKSFLHDLPHEKAVNSACFNPL
DCSKLLTTDQYDEIRVYSSCDWSKPQHIIQHPHRQFQHLTPIKATWHPVYDLIVAGRYPD
DRVCSGDQRTIDIYDSNTAELVYQLYDPTVSGIKSINKFNLMGDVIGSGMGLTVLVWDRN
ESLIRDGDTQQQEDASASVESLRRQRRSRPRTNKERRGPAVDAKLKRKLASLEECETKTK
TKQKQAQMRKK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaaaagcagagctgcggactcagagggatctaaatcgaaggggaaagggaagaagaga
cccgctgagaagtctgctccttctctctccagaacacgacgagacaagaaagatggagaa
acatctaaagcaggaccccctcccctcaagtttgcaggagtccagaggagaggcgtgcac
gggagcatcctgcactacatttataagaacactctgggacaaagtcttcactcacagatg
agacagtgtctccaggagccgttcatccgatctctatcgtcgtatcattttcacagcgcc
accagccccttcgaccgcaggatcacctgtctggagtggaatcctgttcaccacaccact
ctggccgtgggctccaaaggtggagacattcatctgtgggactatgaggtccccacgaaa
aaaagctttattcaggggaatggtgcaggagactttatcggagggatgaagttttgcccc
acagactcctccagagtgtacgtggcctctggtgagggaaatctgagcatgcacagcttt
gagggcctcacacccaccacactgtccagaactcaagactgtggccatgatcaccacaac
gtttgttactggtactgctgtgtcgatgtgtctgtgagcaggcagatgcttgtgacagga
gacaatatgggacagctgttactcctcggactggatggacaaaagattttcagcaacaag
ttgcacaaggccaaagtgacccacgcagagttcaactccagatgtgactggttgttggcg
acggcctcagttgaccacacggtgaagctttgggacctgagaaacataaaggaccagaag
agtttcctgcacgatctgcctcatgaaaaggctgtcaactcagcctgtttcaatccgttg
gactgctccaagctactcaccacagatcagtacgacgagatacgcgtctactcatcctgt
gattggtcgaagcctcaacacatcatccaacatcctcacagacagtttcagcatctcaca
cccatcaaggcaacatggcacccggtgtacgacctgattgtggccggccgctaccctgac
gaccgtgtttgctcaggtgaccagagaaccatcgacatctatgactccaacacagcagag
cttgtgtatcagctgtacgaccccactgtgtcagggatcaaatctattaacaaattcaat
ctcatgggtgatgtgattggatctggaatgggcctgacggttctagtctgggacaggaac
gagtcactgatacgtgatggggacacgcagcagcaggaggacgcctcagcctcagtggaa
agtctgagacggcagaggaggagtcggccgcgcaccaacaaggaacggagaggtccggct
gtggatgcaaagctgaagaggaaactggcttctctggaagaatgtgagaccaagaccaag
acaaaacaaaaacaagctcagatgaggaagaagtga

DBGET integrated database retrieval system