KEGG   Paralichthys olivaceus (Japanese flounder): 109624619
Entry
109624619         CDS       T06037                                 

Gene name
gtse1
Definition
(RefSeq) G2 and S phase-expressed protein 1 isoform X1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109624619 (gtse1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 109624619
NCBI-ProteinID: XP_019934987
LinkDB
Position
Unknown
AA seq 742 aa
MDCRANVDLFFLPDETLDFDVSLSPASFKGDEDEDEVFLGPVSHKEKCVSVNVASHLEDL
DSGVQVSLSPLTEDQLESVCQEALKLATQLQNSELRQPHHEDAETTKMTTDNTTTHREEF
VQDTEAKLDMLSKTARALSPIKRQTFCVQDSPMKELPPAVQHRLLRGSCANTAHSVPTNK
PSSTRHTSINAALSNRPASTALSNRPSSTASSTRPTTRLSTSSPVAVAKAQPRMALRGKV
ALGVGVVLPSKPAAPQSSCSASKSRAEKTRLQPPSKVVGGRRRSPSSRPSSRAESYEDLL
SDSASVASDLSDSSLNSSLLGKRSLAPPTKNVVRKLSGVKAPPLQNRRVTDRKNTSSSSS
SVSSFNSSLSVSPAKGKLNSSLNRSLSSTTAPAPTSINRLANPSKPRRSTVYATAQPTSS
TTGGRRSLSMMGRKLSEVEPIKAVRSTPLKRAEATPLQLTPAKRVFQRTTSVPPTAFVRP
QSGLKPKPEAQVVPTPNGGVRGVHQGDGVSKMLKPKRLVSVSGTESLPQKPTAGPLTPSA
GGCKSLQMKARRPSALPTPVRHRMSAIPTPTPTKTRHAEPPPTSNANTAPSATRMESSCS
PVPADLQEEQPGDAPDIQPFCLEEEQPPDAPPCSAPQPEQSESTEPDTENQVQSEPIKNL
IELGTAEESNVKAQEVLLLDLPAPTLQPQEKLLIDLTNTPDLIRTTGKTCTTNQQLIDLS
SPLIKWSPEDKTNNAPLINLSF
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggactgtcgcgctaacgtcgatctgttctttctgccagatgagacgctggacttcgat
gtttctctgtcacctgccagctttaaaggtgatgaagatgaggatgaggttttcttaggt
ccggttagccataaagagaagtgtgtttcggttaacgtggcatcacatctcgaggacctc
gacagtggtgtgcaggtgagcctcagcccgctgactgaagatcagctggagtctgtgtgt
caggaagcactcaaactagccacccagctgcagaacagcgagctgaggcagccgcaccat
gaggatgccgagaccaccaagatgaccacagacaacactaccacccacagagaggagttc
gtccaggacacagaggccaaactggacatgctcagtaagactgccagagcactaagcccc
atcaaacgccagaccttctgcgtgcaggacagtcccatgaaggagctgccccctgctgtc
cagcatcgcctgctgagaggaagctgcgccaacacagcccatagtgttcccaccaacaaa
ccatcatccacccgccacacctcgatcaatgcagctttatccaaccgtcctgcctctaca
gcattgtccaaccgcccttcctctacagcatcatcaactcgtccaactaccagactcagc
acctccagtcccgttgctgtggccaaggctcaaccaaggatggcactgcgagggaaggtt
gcactgggcgttggtgtcgtgctgccaagcaaaccagccgccccacaatcttcctgttca
gccagcaagagcagagcggagaagaccagactgcaaccaccgagcaaagtggtggggggt
cgaaggcggagcccgtcctcccgtccctccagcagggcagagtcttacgaggatctgctc
tccgattcggcgagcgtggcctctgacctcagcgactcatccctcaactccagcctgctg
ggaaaacgctcattggctccgcccacaaagaatgttgtgaggaagctgtcaggagtgaaa
gctccaccacttcagaacaggagggtgacagacaggaagaacacgtcgtcatcctcatct
tcagtttccagcttcaactccagtttgtctgtgtcccctgctaaaggtaaactaaactca
tctctgaaccggagtctaagcagcaccactgccccggctcccaccagcatcaacagactg
gcaaatcccagcaaaccacgtcgctccactgtctatgccaccgcacagccaacgtcctcc
accactggaggccggcgctcgctgtccatgatggggaggaagctgtctgaggtagagccc
atcaaagcagtcaggtccacgccactgaagagagctgaggccacgcccctccagctgaca
ccagccaagagagtgtttcagaggaccacctccgtcccccccaccgcctttgtccgcccg
caaagtggattgaaacccaaacctgaggctcaggtggtaccaacacccaacggaggagtg
agaggagtccaccaaggagatggcgtctcaaagatgctgaagccaaagagactggtgtca
gtgagcggcacggaaagtcttcctcagaagcctactgcaggtcctctgacgccctctgct
gggggatgcaagtctctgcagatgaaggcgcgtcgtccctctgcccttcccaccccagtg
aggcacaggatgtctgctattcccacacccacgccaaccaagaccaggcatgccgagcca
ccgcccacctctaatgccaacaccgcccccagcgctaccaggatggaaagcagctgcagc
cctgtccctgcggatttacaggaggagcagcctggtgatgccccagatattcaacccttc
tgtctggaggaggaacagccccccgatgcaccaccctgcagtgctccacagcctgaacag
tcagagagcacggagcctgacacagagaatcaggtccaatcagagcccattaaaaacctg
atcgaactggggactgcagaggaaagcaacgtcaaagcacaggaggttctcctgttggat
cttccagctccaacactgcagcctcaagagaaactgcttatcgacctgaccaacacccct
gacctgatcaggacaactggcaagacctgcaccacaaatcagcagctgatcgacctgagc
tctccgctcatcaagtggagtccagaagataagacgaacaacgctccgctcatcaacctc
tcattctga

DBGET integrated database retrieval system