KEGG   Paralichthys olivaceus (Japanese flounder): 109624669
Entry
109624669         CDS       T06037                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109624669 (cdkn1b)
   04068 FoxO signaling pathway
    109624669 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109624669 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109624669
NCBI-ProteinID: XP_019935081
LinkDB
Position
Unknown
AA seq 187 aa
MSNVRLSNGSPTLERTDPRVSEHPKPSACRSLFGSVDHEELNRDLKGHFREMEETASAKW
GFDFARHSPLVNDRLEWELVDCRDVPDFYHRPLRPRSREKGVCSAGNNNVDLNGNHSCVV
VAAPGDDSARSDGQMECTGLRKRPACHEASAQNKRSHSSSSSSEEVISSLSHSAEHTPRK
SSPKRLT
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgactttcaaacgggagcccgacgttggagcggacggacccgcgggtg
tcggagcacccgaagccgtcagcctgcaggagcctgtttggctccgtggaccacgaagag
ttaaacagggatttaaagggacactttcgggagatggaggagactgcttccgccaagtgg
ggcttcgacttcgcccgtcactcgccgctggtcaacgacaggctcgaatgggagttagtg
gactgcagggacgtcccggatttctaccaccggccgctgcggccgaggagcagggagaag
ggcgtctgctccgccgggaataacaatgtggatcttaacgggaatcatagctgtgttgtg
gtggcggctccgggcgacgacagcgccaggtctgacggtcagatggagtgcaccgggctg
aggaagagacctgcgtgccacgaagcctcggcccaaaacaagaggtcacacagcagcagc
agcagctcagaggaggtgatctccagtctgagccactctgcagaacacacacccagaaag
agcagtcccaagaggctgacgtga

DBGET integrated database retrieval system