KEGG   Paralichthys olivaceus (Japanese flounder): 109625045
Entry
109625045         CDS       T06037                                 

Gene name
ccne1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109625045 (ccne1)
   04114 Oocyte meiosis
    109625045 (ccne1)
   04115 p53 signaling pathway
    109625045 (ccne1)
   04218 Cellular senescence
    109625045 (ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109625045 (ccne1)
   03036 Chromosome and associated proteins [BR:pov03036]
    109625045 (ccne1)
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109625045 (ccne1)
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109625045 (ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF4841
Other DBs
NCBI-GeneID: 109625045
NCBI-ProteinID: XP_019935634
LinkDB
Position
Unknown
AA seq 430 aa
MRGKREDTEPESAAPSENTVRSRKRKADVAIYLQDLDEEVAEMTRKKQRDCELTCSPGAG
YKSPHRWIPTPDQEEDRPVALINAGFPHYIINNVFSTPVHCAPLPALCWASKDVVWSNML
EKDKTYTRDVHVMEKHPHLQPKMRAILLDWLMEVSEVYKLHRETYHLAQDYFDRFMATQR
NVFKSTLQLIGITCLFIAAKVEEMYPPKVHQFAYVTDEACTEDEILSMEIIIMKELKWSL
SPQTPISWLNVYMQVAYLKDTDDLLIPRYPQATFTQIAELLDLCMLDVRCLEFSNGLLAA
SALFHFSSLELVENVSALKRVEVEECVRWMVPFAMALRELGGSPMKTYTGIPADDMHNIQ
THVSYLTWLDKAYSYQDVDLKCHSSCSVPSGVLTPPLSSEKTDELVRVDPPVLKIRPRMN
TASPPRHSPK
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcgaggaaaacgggaagacacagaaccagagtctgctgctcccagtgaaaacacagtc
cgatcgaggaagaggaaggcagatgtggctatatatttacaggatctggatgaggaggta
gcagaaatgacgaggaagaagcagcgtgactgtgagctgacctgcagtccaggtgctggt
tacaaaagtccacacaggtggatcccaacacctgatcaggaagaagaccgacctgttgct
cttataaacgcgggcttcccccactacatcatcaacaacgtattttcaacccccgtgcat
tgtgccccactccctgcactgtgctgggccagtaaggatgtggtgtggagcaacatgttg
gagaaggataagacctacaccagagacgtccacgtgatggagaagcatcctcatctgcag
cctaagatgagagctattctcctggactggctcatggaggtgagcgaggtgtacaaactg
cacagggagacataccacctggctcaggactactttgatcgcttcatggccacgcagaga
aacgtcttcaaatcaacgctgcagctcataggcatcacctgtctcttcatcgctgccaaa
gtagaggaaatgtatcctcccaaggtccaccagtttgcctatgttacagacgaggcctgc
actgaagatgagattctcagtatggaaatcattattatgaaggagctgaagtggagtttg
agcccgcagactcccatctcctggctcaatgtgtacatgcaggtggcttacctgaaagac
acggacgacctgctcatccccagatatccacaggccacattcacacagatagcagagttg
ttggacctttgtatgcttgatgtgcgctgccttgagttttccaatggcctccttgctgcg
tccgctctgtttcacttctcctctctggagctggtggaaaacgtttcagctttgaagagg
gtggaggtggaggagtgtgtgaggtggatggttccatttgccatggcactgcgggagctg
ggcgggtcgcctatgaaaacgtacacaggaatccctgcagatgacatgcacaacatccag
acccatgtttcttatctcacatggctggacaaggcctactcttaccaggatgtggacttg
aagtgtcacagcagctgttcagtcccttcaggtgtcctgactccacccctgagcagtgag
aagactgacgagctggtccgagtggatccccctgtcctgaaaattagaccgaggatgaat
actgcatctccaccgcgacattctccaaagtag

KEGG   Paralichthys olivaceus (Japanese flounder): 109640569
Entry
109640569         CDS       T06037                                 

Definition
(RefSeq) G1/S-specific cyclin-E2-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109640569
   04114 Oocyte meiosis
    109640569
   04115 p53 signaling pathway
    109640569
   04218 Cellular senescence
    109640569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109640569
   03036 Chromosome and associated proteins [BR:pov03036]
    109640569
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109640569
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109640569
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109640569
NCBI-ProteinID: XP_019960208
LinkDB
Position
Unknown
AA seq 381 aa
MTRQSGRLQKRSENAPGLKSKVSKQSNRKKFQPLSKLQCEKNQLIRKGVTKPCVVIETPV
KGARIDCDDNNHQVPTASDPLARPSPLPPLGWGSPEDVWGKMVGKEQNYRHSKSFMQKHP
RIQPRMRSILLDWLIEVSEAYTLHRQTFYLAQDYFDRFMLTQNNVEKNVLQLIGITCLFI
ASKMEEACPPKLSQMAHVTAGTYFEEEILQMELIILKALSWNLCPETAVSWLKLYFQMAS
MSANSDLLESQFPHDPYVQMTRLLDLCVLSLNSLDFQYRVLAASVLCHFLQQETVEKVSG
LSRDVLQPCLNWMAPFVESVGRFGRATPKDFARVKEDRHNIQTHTDYMTLLDDVSKNEVN
GEFLTPPSSTEKTHSEEETLK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacaagacaaagtggtcgcctgcaaaaaagatctgaaaatgctccagggctgaaaagc
aaagtttcaaagcaaagcaacaggaaaaagttccagcccttgtcaaagctgcagtgtgag
aagaaccagctgattcgtaaaggcgtcaccaagccctgtgttgtcatcgagactcccgtg
aagggagccaggatcgactgtgacgacaacaaccatcaagttcccaccgccagcgatccc
ttggctcggccgtcccctctgcctcctctggggtggggctctcctgaagatgtgtggggg
aagatggttggaaaggagcagaactacagacacagtaagagcttcatgcagaaacacccc
aggatacaacccagaatgagatccatcctcctcgactggttaatcgaggtgagtgaggcg
tacacgcttcaccggcagacgttctatctggcgcaggattacttcgaccgcttcatgttg
acccagaacaacgttgaaaagaatgtgctgcagctcattgggatcacatgtctttttata
gcatccaagatggaggaagcttgtcccccgaaactctcacagatggcgcatgtgactgca
gggacctactttgaggaagagattcttcaaatggagttaatcattttaaaggcgttaagt
tggaacctctgcccggaaacagctgtgtcgtggctgaagctttatttccagatggcttcg
atgagcgccaactccgacctgctggagtcgcagtttccacacgacccctacgtccaaatg
acacgacttctagatctctgtgtcctcagtttaaactctctggacttccagtatcgagtg
ttggcggcttcagtcctgtgtcatttccttcagcaggaaacagttgaaaaggtctcaggt
ctgtcgagagacgtcctccagccatgcctgaactggatggctcccttcgtcgaatcagtc
ggtcgcttcggccgagcgacaccaaaggattttgccagagtgaaagaagacagacacaac
atccagacgcacacagactacatgaccctgctggatgacgtcagtaaaaacgaagtgaac
ggcgagttcctcactcctccgagcagcacagagaaaacacacagcgaggaggagacgctg
aagtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109645281
Entry
109645281         CDS       T06037                                 

Definition
(RefSeq) G1/S-specific cyclin-E2-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109645281
   04114 Oocyte meiosis
    109645281
   04115 p53 signaling pathway
    109645281
   04218 Cellular senescence
    109645281
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109645281
   03036 Chromosome and associated proteins [BR:pov03036]
    109645281
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109645281
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109645281
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109645281
NCBI-ProteinID: XP_019966396
LinkDB
Position
Unknown
AA seq 395 aa
MSRRSGRITLQARDSNTPEPTVRAPLKKRKSEPSKKKLQPAAKKQSYEIQKCWSEDGASP
CVLIETPHKELEPSDPSSFKQYIFKNLFIKASPIPRLSWASSDDVWIKMLNKELKYVHDK
GYLQRHPKLQPNMRAILLDWLLEVSEVYSLHRQTAYLAQDFFDRFMLTQENVNKDYLQLI
GITALFIASKIEEIYPPKIYEFAYVTDGACDMWDIQRTELHILKALDWNLCPETPISWLK
LYAQVEAQKDDENFLVPQFSQETYIQITQLLDLSLMDINSLDYGYSVLAAAAFCHFSTFD
VVHKVSGLTWESVAPCVRWMSPFMDTLQSEAPPQLKNFPRVKADDRHNIQTHVSYLELLR
KAQERRVDDPDCHMSPVAVGAILTPPNSTEKPTNP
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtccagacgcagtggtcgcatcacacttcaagccagagattcgaacacacctgagccg
accgtcagagcaccactgaagaagaggaaatcagagccgtccaagaagaaactacaacct
gctgctaagaaacaaagctatgaaatacagaagtgttggtcagaggacggtgcgagtccg
tgcgtgctcatagaaactccccacaaagagctggagccttcggacccgtccagcttcaaa
cagtacatattcaagaacctcttcatcaaggcctcgcccatcccccgcctcagttgggcc
agttcagacgacgtgtggatcaagatgctcaacaaggagctgaagtacgtccacgacaag
ggttacctgcagcggcatcccaagctgcagccgaacatgagggccattctgctggactgg
ctgctcgaggtgagtgaggtgtacagcctccaccggcagacggcctacctcgcgcaggac
ttctttgaccgcttcatgctgacgcaggagaacgtcaacaaagactacctgcagctcatc
ggcatcacggcgctgttcatcgcctccaagatcgaggaaatttacccgcccaaaatctac
gagttcgcctacgtcacagacggcgcctgcgacatgtgggacatccagcgcacagagctt
cacatactgaaggcgttggactggaacctctgtccggagacgcccatctcctggctgaag
ctgtacgctcaggttgaagcccagaaagacgacgagaacttcctggtgccacagttctca
caggaaacgtacatccagatcacacagctgttggatctgagtttgatggacatcaactcg
ttggactatggctacagcgtcctcgctgccgccgccttctgccacttctccaccttcgac
gtcgtccataaagtctcgggtctgacgtgggagagcgtggcgccctgcgtccggtggatg
tctcctttcatggacacgctgcaatctgaagccccgccccagctcaagaacttcccccga
gtcaaagccgacgacagacacaacatccagacgcacgtgtcctatctggagctgctgaga
aaagctcaggagcgtcgggtggacgaccccgactgtcatatgtcgccggtcgccgtcgga
gcgatcctgactccacccaacagcacagagaaaccgaccaatccctga

DBGET integrated database retrieval system